RegulonDB RegulonDB 10.9: Gene Form
   

yedA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcm yedA yedI vsr TSS_2276 TSS_2276 yedIp2 yedIp2 TSS_2275 TSS_2275 TSS_2274 (cluster) TSS_2274 (cluster) yedIp3 yedIp3 yodCp6 yodCp6

Gene      
Name: yedA    Texpresso search in the literature
Synonym(s): ECK1957, EG11141, b1959
Genome position(nucleotides): 2029539 --> 2030459 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.64
External database links:  
ASAP:
ABE-0006505
ECHOBASE:
EB1131
ECOLIHUB:
yedA
OU-MICROARRAY:
b1959
STRING:
511145.b1959
COLOMBOS: yedA


Product      
Name: putative transporter YedA
Synonym(s): YedA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 32.194
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
149 -> 169 PWGAILILIGSISWAFGSVYG
14 -> 140 FALYIIWGSTYFVIRIGVESWPPLMMAGVRFLAAGILLLAFLLLRGHKLPPLRPLLNAALIGLLLLAVGNGMVTVAEHQNVPSGIAAVVVATVPLFTLCFSRLFGIKTRKLEWVGIAIGLAGIIMLN
18 -> 141 IIWGSTYFVIRIGVESWPPLMMAGVRFLAAGILLLAFLLLRGHKLPPLRPLLNAALIGLLLLAVGNGMVTVAEHQNVPSGIAAVVVATVPLFTLCFSRLFGIKTRKLEWVGIAIGLAGIIMLNS
68 -> 88 LLNAALIGLLLLAVGNGMVTV
240 -> 260 ALATSYAYVNPVVAVLLGTGL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0009636 - response to toxic substance
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Phadtare S., et al., 2004
[3] Zakataeva NP., et al., 2006
External database links:  
ECOCYC:
EG11141-MONOMER
ECOLIWIKI:
b1959
INTERPRO:
IPR000620
INTERPRO:
IPR004779
PFAM:
PF00892
PRIDE:
P0AA70
REFSEQ:
NP_416468
UNIPROT:
P0AA70


Operon      
Name: yedA         
Operon arrangement:
Transcription unit        Promoter
yedA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yodCp6 2028504 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter yedIp3 2029370 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2274 (cluster) 2029390 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2275 2029392 reverse nd [RS-EPT-CBR] [5]
  promoter yedIp2 2029461 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_2276 2031452 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Phadtare S., Inouye M., 2004, Genome-wide transcriptional analysis of the cold shock response in wild-type and cold-sensitive, quadruple-csp-deletion strains of Escherichia coli., J Bacteriol 186(20):7007-14

 [3] Zakataeva NP., Kutukova EA., Gronskii SV., Troshin PV., Livshits VA., Aleshin VV., 2006, [Export of metabolites by the proteins of the DMT and RhtB families and its possible role in intercellular communication], Mikrobiologiia 75(4):509-20

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB