RegulonDB RegulonDB 10.8: Gene Form
   

ubiG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfaL gyrA ubiG CspA CspA CspA Fis TSS_2508 (cluster) TSS_2508 (cluster) ubiGp ubiGp gyrAp gyrAp TSS_2505 TSS_2505 TSS_2504 TSS_2504 TSS_2503 TSS_2503 TSS_2502 TSS_2502

Gene      
Name: ubiG    Texpresso search in the literature
Synonym(s): ECK2224, EG11143, b2232, pufX, yfaB
Genome position(nucleotides): 2339567 --> 2340289 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.22
External database links:  
ASAP:
ABE-0007374
CGSC:
44
ECHOBASE:
EB1133
OU-MICROARRAY:
b2232
PortEco:
ubiG
STRING:
511145.b2232
COLOMBOS: ubiG


Product      
Name: bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase
Synonym(s): PufX, UbiG, YfaB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 26.555
Isoelectric point: 6.59
Motif(s):
 
Type Positions Sequence
57 -> 186 GKKVLDVGCGGGILAESMAREGATVTGLDMGFEPLQVAKLHALESGIQVDYVQETVEEHAAKHAGQYDVVTCMEMLEHVPDPQSVVRACAQLVKPGGDVFFSTLNRNGKSWLMAVVGAEYILRMVPKGTH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0110142 - ubiquinone biosynthesis complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009898 - cytoplasmic side of plasma membrane
molecular_function GO:0099119 - 3-demethylubiquinol-8 3-O-methyltransferase activity
GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0043431 - 2-octaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinone methyltransferase activity
GO:0008425 - 2-polyprenyl-6-methoxy-1,4-benzoquinone methyltransferase activity
GO:0008689 - 3-demethylubiquinone-9 3-O-methyltransferase activity
GO:0061542 - 3-demethylubiquinol-n 3-O-methyltransferase activity
GO:1901611 - phosphatidylglycerol binding
biological_process GO:0006744 - ubiquinone biosynthetic process
GO:0042538 - hyperosmotic salinity response
GO:0032259 - methylation
Note(s): Note(s): ...[more].
Reference(s): [1] Gonidakis S., et al., 2011
[2] Polglase WJ., et al., 1966
[3] Zhu Y., et al., 2015
External database links:  
DIP:
DIP-11070N
ECOCYC:
DHHB-METHYLTRANSFER-MONOMER
ECOLIWIKI:
b2232
INTERPRO:
IPR029063
INTERPRO:
IPR010233
MINT:
MINT-1254635
MODBASE:
P17993
PANTHER:
PTHR23134
PDB:
5DPM
PDB:
4KDC
PDB:
4KDR
PFAM:
PF13489
PRIDE:
P17993
PRODB:
PRO_000024159
REFSEQ:
NP_416735
SMR:
P17993
UNIPROT:
P17993


Operon      
Name: ubiG         
Operon arrangement:
Transcription unit        Promoter
ubiG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2502 2338373 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2503 2338375 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2504 2338445 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2505 2338825 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2508 (cluster) 2339547 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gonidakis S., Finkel SE., Longo VD., 2011, Lifespan extension and paraquat resistance in a ubiquinone-deficient Escherichia coli mutant depend on transcription factors ArcA and TdcA., Aging (Albany NY) 3(3):291-303

 [2] Polglase WJ., Pun WT., Withaar J., 1966, Lipoquinones of Escherichia coli., Biochim Biophys Acta 118(2):425-6

 [3] Zhu Y., Wu B., Zhang X., Fan X., Niu L., Li X., Wang J., Teng M., 2015, Structural and biochemical studies reveal UbiG/Coq3 as a class of novel membrane-binding proteins., Biochem J 470(1):105-14

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB