RegulonDB RegulonDB 10.9: Gene Form
   

ppdC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recC ppdB ygdB ppdC ppdA recCp recCp

Gene      
Name: ppdC    Texpresso search in the literature
Synonym(s): ECK2819, EG11154, b2823, ygdA
Genome position(nucleotides): 2962441 <-- 2962764 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.94
External database links:  
ASAP:
ABE-0009257
ECHOBASE:
EB1143
ECOLIHUB:
ppdC
OU-MICROARRAY:
b2823
STRING:
511145.b2823
COLOMBOS: ppdC


Product      
Name: prepilin-type N-terminal cleavage/methylation domain-containing protein PpdC
Synonym(s): PpdC, YgdA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.004
Isoelectric point: 11.711
Motif(s):
 
Type Positions Sequence
6 -> 30 KNQQGFSLPEVMLAMVLMVMIVTAL
11 -> 107 FSLPEVMLAMVLMVMIVTALSGFQRTLMNSLASRNQYQQLWRHGWQQTQLRAISPPANWQVNRMQTSQAGCVSISVTLVSPGGREGEMTRLHCPNRQ
13 -> 34 LPEVMLAMVLMVMIVTALSGFQ
33 -> 104 FQRTLMNSLASRNQYQQLWRHGWQQTQLRAISPPANWQVNRMQTSQAGCVSISVTLVSPGGREGEMTRLHCP
1 -> 10 MSASLKNQQG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Cisneros DA., et al., 2012
External database links:  
ECOCYC:
EG11154-MONOMER
ECOLIWIKI:
b2823
INTERPRO:
IPR012902
INTERPRO:
IPR022204
PFAM:
PF07963
PFAM:
PF12528
PRIDE:
P08372
PROSITE:
PS00409
REFSEQ:
NP_417300
UNIPROT:
P08372


Operon      
Name: ppdAB-ygdB-ppdC-recC         
Operon arrangement:
Transcription unit        Promoter
recC
ppdAB-ygdB-ppdC-recC


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Cisneros DA., Pehau-Arnaudet G., Francetic O., 2012, Heterologous assembly of type IV pili by a type II secretion system reveals the role of minor pilins in assembly initiation., Mol Microbiol 86(4):805-18


RegulonDB