RegulonDB RegulonDB 10.8: Gene Form
   

ygdB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recC ppdB ppdA ygdB ppdC recCp recCp

Gene      
Name: ygdB    Texpresso search in the literature
Synonym(s): ECK2820, EG11155, b2824
Genome position(nucleotides): 2962749 <-- 2963156 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.7
External database links:  
ASAP:
ABE-0009261
ECHOBASE:
EB1144
OU-MICROARRAY:
b2824
PortEco:
ygdB
STRING:
511145.b2824
COLOMBOS: ygdB


Product      
Name: DUF2509 domain-containing protein YgdB
Synonym(s): YgdB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 14.973
Isoelectric point: 7.088
Motif(s):
 
Type Positions Sequence
1 -> 26 MNREKGVSSLALVLMLLVLGSLLLQG
27 -> 135 MSQQDRSFASRVSMESQSLRRQAIVQSALAWGKMHCWQTQPAVQCSQYAETDAQVCLRLLADNEALLIAGYEGVSLWRTGEVIDGNIVFSPRGWSDFCPLKERALCQLP
15 -> 132 MLLVLGSLLLQGMSQQDRSFASRVSMESQSLRRQAIVQSALAWGKMHCWQTQPAVQCSQYAETDAQVCLRLLADNEALLIAGYEGVSLWRTGEVIDGNIVFSPRGWSDFCPLKERALC

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Reference(s): [1] Cisneros DA., et al., 2012
External database links:  
ECOCYC:
EG11155-MONOMER
ECOLIWIKI:
b2824
INTERPRO:
IPR019652
PFAM:
PF10713
PRIDE:
P08370
REFSEQ:
NP_417301
UNIPROT:
P08370


Operon      
Name: ppdAB-ygdB-ppdC-recC         
Operon arrangement:
Transcription unit        Promoter
recC
ppdAB-ygdB-ppdC-recC


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Cisneros DA., Pehau-Arnaudet G., Francetic O., 2012, Heterologous assembly of type IV pili by a type II secretion system reveals the role of minor pilins in assembly initiation., Mol Microbiol 86(4):805-18


RegulonDB