RegulonDB RegulonDB 10.9: Gene Form
   

ppdB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thyA ppdB ppdA ygdB ppdC anti-anti-terminator anti-terminator terminator ppdAp ppdAp recCp recCp

Gene      
Name: ppdB    Texpresso search in the literature
Synonym(s): ECK2821, EG11156, b2825, ygdC
Genome position(nucleotides): 2963153 <-- 2963716 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.3
External database links:  
ASAP:
ABE-0009263
ECHOBASE:
EB1145
ECOLIHUB:
ppdB
OU-MICROARRAY:
b2825
STRING:
511145.b2825
COLOMBOS: ppdB


Product      
Name: prepilin-type N-terminal cleavage/methylation domain-containing protein PpdB
Synonym(s): PpdB, YgdC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 20.519
Isoelectric point: 5.283
Motif(s):
 
Type Positions Sequence
1 -> 7 MPVKEQG
4 -> 27 KEQGFSLLEVLIAMAISSVLLLGA
8 -> 187 FSLLEVLIAMAISSVLLLGAARFLPALQRESLTSTRKLALEDEIWLRVFTVAKHLQRAGYCHGICTGEGLEIVGQGDCVIVQWDANSNGIWDREPVKESDQIGFRLKEHVLETLRGATSCEGKGWDKVTNPDAIIIDTFQVVRQDVSGFSPVLTVNMRAASKSEPQTVVNASYSVTGFNL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0015628 - protein secretion by the type II secretion system
Note(s): Note(s): ...[more].
Reference(s): [1] Cisneros DA., et al., 2012
External database links:  
ECOCYC:
EG11156-MONOMER
ECOLIWIKI:
b2825
INTERPRO:
IPR012902
INTERPRO:
IPR016419
PFAM:
PF07963
PRIDE:
P08371
PROSITE:
PS00409
REFSEQ:
NP_417302
SMR:
P08371
UNIPROT:
P08371


Operon      
Name: ppdAB-ygdB-ppdC-recC         
Operon arrangement:
Transcription unit        Promoter
recC
ppdAB-ygdB-ppdC-recC


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Cisneros DA., Pehau-Arnaudet G., Francetic O., 2012, Heterologous assembly of type IV pili by a type II secretion system reveals the role of minor pilins in assembly initiation., Mol Microbiol 86(4):805-18


RegulonDB