RegulonDB RegulonDB 10.9: Gene Form
   

argO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mscS yggE argO och5 Lrp Lrp ArgP Lrp ArgP argOp argOp yggEp2 yggEp2 yggEp1 yggEp1

Gene      
Name: argO    Texpresso search in the literature
Synonym(s): ECK2919, EG11159, b2923, yggA
Genome position(nucleotides): 3068173 <-- 3068808 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.79
External database links:  
ASAP:
ABE-0009591
ECHOBASE:
EB1148
ECOLIHUB:
argO
OU-MICROARRAY:
b2923
STRING:
511145.b2923
COLOMBOS: argO


Product      
Name: L-arginine exporter
Synonym(s): ArgO, YggA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 23.176
Isoelectric point: 9.809
Motif(s):
 
Type Positions Sequence
111 -> 131 IIATMLAVTWLNPHVYLDTFV
1 -> 38 MFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIM
63 -> 91 MQSPWLLALVTWGGVAFLLWYGFGAFKTA
160 -> 160 F
173 -> 200 RLRTAKAQRIINLVVGCVMWFIALQLAR

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015171 - amino acid transmembrane transporter activity
GO:0015181 - arginine transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0015809 - arginine transport
GO:0003333 - amino acid transmembrane transport
GO:1902023 - L-arginine transport
GO:1903826 - arginine transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Marbaniang CN., et al., 2012
External database links:  
ECOCYC:
YGGA-MONOMER
ECOLIWIKI:
b2923
INTERPRO:
IPR023445
INTERPRO:
IPR004777
INTERPRO:
IPR001123
PANTHER:
PTHR30086
PFAM:
PF01810
PRIDE:
P11667
PRODB:
PRO_000022133
REFSEQ:
NP_417398
UNIPROT:
P11667


Operon      
Name: argO         
Operon arrangement:
Transcription unit        Promoter
argO


Transcriptional Regulation      
Display Regulation             
Activated by: ArgP, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Marbaniang CN., Gowrishankar J., 2012, Transcriptional cross-regulation between Gram-negative and gram-positive bacteria, demonstrated using ArgP-argO of Escherichia coli and LysG-lysE of Corynebacterium glutamicum., J Bacteriol 194(20):5657-66


RegulonDB