RegulonDB RegulonDB 10.9: Gene Form
   

ttdB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ttdT ttdR ttdA ttdB Dan Dan Dan Dan Dan ttdAp ttdAp ttdRp ttdRp TSS_3367 TSS_3367

Gene      
Name: ttdB    Texpresso search in the literature
Synonym(s): ECK3052, EG11169, b3062, ygjB
Genome position(nucleotides): 3207371 --> 3207976 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.96
External database links:  
ASAP:
ABE-0010052
CGSC:
33462
ECHOBASE:
EB1157
ECOLIHUB:
ttdB
OU-MICROARRAY:
b3062
STRING:
511145.b3062
COLOMBOS: ttdB


Product      
Name: L(+)-tartrate dehydratase subunit β
Synonym(s): TtdB, YgjB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.679
Isoelectric point: 6.62
Motif(s):
 
Type Positions Sequence
80 -> 85 SMRMES
165 -> 165 V
6 -> 175 TTPIKAEDLQDIRVGDVIYLTGTLVTCRDVCHRRLIELKRPIPYDLNGKAIFHAGPIVRKNGDKWEMVSVGPTTSMRMESFEREFIEQTGVKLVVGKGGMGPLTEEGCQKFKALHVIFPAGCAVLAATQVEEIEEVHWTELGMPESLWVCRVKEFGPLIVSIDTHGNNLI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0016836 - hydro-lyase activity
GO:0008730 - L(+)-tartrate dehydratase activity
biological_process GO:0009408 - response to heat
Note(s): Note(s): ...[more].
Reference(s): [1] Nesin M., et al., 1987
[2] Xu Y., et al., 2008
External database links:  
ECOCYC:
TTDB-MONOMER
ECOLIWIKI:
b3062
INTERPRO:
IPR004647
INTERPRO:
IPR036660
PFAM:
PF05683
PRIDE:
P0AC35
PRODB:
PRO_000024138
REFSEQ:
NP_417534
SMR:
P0AC35
UNIPROT:
P0AC35


Operon      
Name: ttdABT         
Operon arrangement:
Transcription unit        Promoter
ttdABT


Transcriptional Regulation      
Display Regulation             
Activated by: Dan


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3367 3206279 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nesin M., Lupski JR., Svec P., Godson GN., 1987, Possible new genes as revealed by molecular analysis of a 5-kb Escherichia coli chromosomal region 5' to the rpsU-dnaG-rpoD macromolecular-synthesis operon., Gene 51(2-3):149-61

 [2] Xu Y., Gao Y., 2008, [In vitro cross-linking of Escherichia coli tartrate dehydratase beta subunit]., Sheng Wu Gong Cheng Xue Bao 24(8):1485-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB