RegulonDB RegulonDB 10.8: Gene Form
   

rimP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nusA rimP metY anti-anti-terminator anti-terminator terminator rimPp rimPp TSS_3471 TSS_3471 TSS_3470 TSS_3470 TSS_3469 (cluster) TSS_3469 (cluster) TSS_3468 TSS_3468 TSS_3467 (cluster) TSS_3467 (cluster) nusAp nusAp TSS_3466 TSS_3466

Gene      
Name: rimP    Texpresso search in the literature
Synonym(s): ECK3159, EG11179, b3170, yhbC
Genome position(nucleotides): 3317554 <-- 3318006 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.57
External database links:  
ASAP:
ABE-0010417
ECHOBASE:
EB1166
OU-MICROARRAY:
b3170
PortEco:
rimP
STRING:
511145.b3170
COLOMBOS: rimP


Product      
Name: ribosome maturation factor RimP
Synonym(s): RimP, YhbC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.651
Isoelectric point: 4.329
Motif(s):
 
Type Positions Sequence
85 -> 150 LFTAEHYARFVGEEVTLVLRMAVQNRRKWQGVIKAVDGEMITVTVEGKDEVFALSNIQKANLVPHF
12 -> 82 ITAPVEALGFELVGIEFIRGRTSTLRIYIDSEDGINVDDCADVSHQVSAVLDVEDPITVAYNLEVSSPGLD
9 -> 9 T

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0006412 - translation
GO:0042254 - ribosome biogenesis
GO:0042274 - ribosomal small subunit biogenesis
GO:0000028 - ribosomal small subunit assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Nord S., et al., 2009
External database links:  
DIP:
DIP-47892N
ECOCYC:
EG11179-MONOMER
ECOLIWIKI:
b3170
INTERPRO:
IPR036847
INTERPRO:
IPR035956
INTERPRO:
IPR028998
INTERPRO:
IPR028989
INTERPRO:
IPR003728
MINT:
MINT-1219023
MODBASE:
P0A8A8
PANTHER:
PTHR33867
PFAM:
PF02576
PFAM:
PF17384
PRIDE:
P0A8A8
PRODB:
PRO_000023764
REFSEQ:
NP_417639
SMR:
P0A8A8
UNIPROT:
P0A8A8


Operon      
Name: metY-rimP-nusA-infB-rbfA-truB-rpsO-pnp         
Operon arrangement:
Transcription unit        Promoter
pnp
rpsO
rpsO-pnp
infB
nusA-infB
rimP-nusA-infB
metY
metY-yhbC-nusA-infB
metY-yhbC-nusA-infB-rbfA-truB-rpsO-pnp
metY
metY-yhbC-nusA-infB-rbfA-truB-rpsO-pnp


Transcriptional Regulation      
Display Regulation             
Activated by: Fis
Repressed by: CRP, ArgR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3466 3316378 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3467 (cluster) 3317609 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3468 3317627 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3469 (cluster) 3317768 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3470 3317880 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3471 3317926 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nord S., Bylund GO., Lovgren JM., Wikstrom PM., 2009, The RimP protein is important for maturation of the 30S ribosomal subunit., J Mol Biol 386(3):742-53

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB