RegulonDB RegulonDB 10.9: Gene Form
   

xanP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yicH xanP gltS yicHp yicHp xanPp4 xanPp4 xanPp5 xanPp5 TSS_4244 TSS_4244 gltSp3 gltSp3

Gene      
Name: xanP    Texpresso search in the literature
Synonym(s): ECK3644, EG11194, b3654, yicE
Genome position(nucleotides): 3828945 --> 3830336 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.89
External database links:  
ASAP:
ABE-0011946
ECHOBASE:
EB1180
ECOLIHUB:
xanP
OU-MICROARRAY:
b3654
STRING:
511145.b3654
COLOMBOS: xanP


Product      
Name: xanthine:H+ symporter XanP
Synonym(s): XanP, YicE, xanthine NCS2 transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 48.868
Isoelectric point: 7.454
Motif(s):
 
Type Positions Sequence
71 -> 91 IISMSLFASGVASIIQIKAWG
352 -> 372 GFVVALMLIVLGLFPAVSGFV
34 -> 426 QTLFAACQHLLAMFVAVITPALLICQALGLPAQDTQHIISMSLFASGVASIIQIKAWGPVGSGLLSIQGTSFNFVAPLIMGGTALKTGGADVPTMMAALFGTLMLASCTEMVISRVLHLARRIITPLVSGVVVMIIGLSLIQVGLTSIGGGYAAMSDNTFGAPKNLLLAGVVLALIILLNRQRNPYLRVASLVIAMAAGYALAWFMGMLPESNEPMTQELIMVPTPLYYGLGIEWSLLLPLMLVFMITSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSFVSAVFNTFPNSCFGQNNGVIQLTGVASRYVGFVVALMLIVLGLFPAVSGFVQHIPEPVLGGATLVMFGTIAASGVRIVSREPLNRRAILIIALSLAVGLGVSQQP
260 -> 280 LYYGLGIEWSLLLPLMLVFMI
43 -> 63 LLAMFVAVITPALLICQALGL

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:0042907 - xanthine transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0042906 - xanthine transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YICE-MONOMER
ECOLIWIKI:
b3654
INTERPRO:
IPR006042
INTERPRO:
IPR006043
PFAM:
PF00860
PRIDE:
P0AGM9
PROSITE:
PS01116
REFSEQ:
NP_418111
UNIPROT:
P0AGM9


Operon      
Name: xanP         
Operon arrangement:
Transcription unit        Promoter
xanP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gltSp3 3828691 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4244 3828765 reverse nd [RS-EPT-CBR] [2]
  promoter xanPp5 3828821 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter xanPp4 3828919 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB