RegulonDB RegulonDB 10.9: Gene Form
   

nsrR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rnr purA nsrR TSS_5051 TSS_5051 TSS_5050 (cluster) TSS_5050 (cluster) TSS_5049 TSS_5049 TSS_5048 TSS_5048 TSS_5047 (cluster) TSS_5047 (cluster) TSS_5046 TSS_5046 nsrRp nsrRp TSS_5045 TSS_5045 TSS_5044 TSS_5044 TSS_5043 TSS_5043 TSS_5042 TSS_5042 TSS_5041 TSS_5041 TSS_5040 TSS_5040 TSS_5039 (cluster) TSS_5039 (cluster) TSS_5038 TSS_5038 TSS_5037 TSS_5037 TSS_5036 TSS_5036 TSS_5035 TSS_5035 TSS_5034 TSS_5034 TSS_5033 TSS_5033 TSS_5032 (cluster) TSS_5032 (cluster) TSS_5031 TSS_5031 TSS_5030 (cluster) TSS_5030 (cluster)

Gene      
Name: nsrR    Texpresso search in the literature
Synonym(s): ECK4174, EG11212, b4178, yjeB
Genome position(nucleotides): 4406190 --> 4406615 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.36
External database links:  
ASAP:
ABE-0013676
ECHOBASE:
EB1197
ECOLIHUB:
nsrR
OU-MICROARRAY:
b4178
STRING:
511145.b4178
COLOMBOS: nsrR


Product      
Name: DNA-binding transcriptional repressor NsrR
Synonym(s): NsrR, YjeB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: Rrf2
Cellular location: cytosol
Molecular weight: 15.593
Isoelectric point: 8.039
Motif(s):
 
Type Positions Sequence
2 -> 129 QLTSFTDYGLRALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPASAIRIGDVVRELEPLSLVNCSSEFCHITPACRLKQALSKAVQSFLTELDNYTLADLVE
3 -> 130 LTSFTDYGLRALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPASAIRIGDVVRELEPLSLVNCSSEFCHITPACRLKQALSKAVQSFLTELDNYTLADLVEE
28 -> 51 ISEVTDVYGVSRNHMVKIINQLSR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
GO:0003700 - DNA-binding transcription factor activity
GO:0003690 - double-stranded DNA binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0005506 - iron ion binding
GO:0070026 - nitric oxide binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-48211N
ECOCYC:
EG11212-MONOMER
ECOLIWIKI:
b4178
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR000944
INTERPRO:
IPR023761
INTERPRO:
IPR030489
MODBASE:
P0AF63
PANTHER:
PTHR33221
PFAM:
PF02082
PRIDE:
P0AF63
PRODB:
PRO_000023418
PROSITE:
PS51197
PROSITE:
PS01332
REFSEQ:
NP_418599
SMR:
P0AF63
UNIPROT:
P0AF63


Operon      
Name: nsrR-rnr-rlmB-yjfIJ         
Operon arrangement:
Transcription unit        Promoter
nsrR-rnr-rlmB-yjfI
yjfIJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5030 (cluster) 4404691 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_5031 4404694 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5032 (cluster) 4404734 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_5033 4404739 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5034 4404742 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_5035 4404745 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5036 4404753 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5037 4404830 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5038 4404833 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5039 (cluster) 4404835 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_5040 4404848 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5041 4404852 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5042 4405214 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5043 4405777 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5044 4405781 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5045 4405785 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5046 4406415 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5047 (cluster) 4406597 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_5048 4406668 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5049 4406974 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5050 (cluster) 4407052 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_5051 4407074 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB