RegulonDB RegulonDB 10.9: Gene Form
   

fliO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliP fliN fliO fliQ fliM

Gene      
Name: fliO    Texpresso search in the literature
Synonym(s): ECK1945, EG11224, b1947, flbD
Genome position(nucleotides): 2021504 --> 2021869 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.64
External database links:  
ASAP:
ABE-0006473
CGSC:
17510
ECHOBASE:
EB1206
ECOLIHUB:
fliO
OU-MICROARRAY:
b1947
STRING:
511145.b1947
COLOMBOS: fliO


Product      
Name: flagellar biosynthesis protein FliO
Synonym(s): FlbD, FliO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cell projection
Molecular weight: 12.67
Isoelectric point: 11.301
Motif(s):
 
Type Positions Sequence
37 -> 116 WLVKRLGFAPKRTGVNGLKISASASLGARERVVVVDVEDARLVLGVTAGQINLLHKLPPSAPTEEIPQTDFQSVMKNLLK
18 -> 18 L
19 -> 39 LQVSGALIAIIALILAAAWLV
15 -> 15 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0009288 - bacterial-type flagellum
GO:0009425 - bacterial-type flagellum basal body
biological_process GO:0006935 - chemotaxis
GO:0044781 - bacterial-type flagellum organization
GO:0097588 - archaeal or bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11224-MONOMER
ECOLIWIKI:
b1947
INTERPRO:
IPR022781
PFAM:
PF04347
PRIDE:
P22586
REFSEQ:
NP_416457
UNIPROT:
P22586


Operon      
Name: fliLMNOPQR         
Operon arrangement:
Transcription unit        Promoter
fliLMNOPQR
fliLMNOPQR


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB