RegulonDB RegulonDB 10.9: Gene Form
   

dcuA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aspA dcuA cutA dsbD anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator TSS_4946 TSS_4946 TSS_4945 TSS_4945 TSS_4944 TSS_4944 dcuAp2 dcuAp2 dcuAp dcuAp TSS_4943 TSS_4943 TSS_4942 TSS_4942 TSS_4941 (cluster) TSS_4941 (cluster) TSS_4940 TSS_4940 TSS_4939 TSS_4939 TSS_4938 TSS_4938 TSS_4937 TSS_4937 TSS_4936 TSS_4936 TSS_4935 TSS_4935 TSS_4934 TSS_4934 cutAp cutAp

Gene      
Name: dcuA    Texpresso search in the literature
Synonym(s): ECK4132, EG11225, b4138, genA
Genome position(nucleotides): 4365472 <-- 4366773 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.61
External database links:  
ASAP:
ABE-0013546
CGSC:
34476
ECHOBASE:
EB1207
ECOLIHUB:
dcuA
OU-MICROARRAY:
b4138
STRING:
511145.b4138
COLOMBOS: dcuA


Product      
Name: C4-dicarboxylate transporter DcuA
Synonym(s): DcuA, GenA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 45.751
Isoelectric point: 7.878
Motif(s):
 
Type Positions Sequence
1 -> 18 MLVVELIIVLLAIFLGAR
86 -> 103 YITILAPIVTYFLTIFAG
293 -> 310 GMSACICILGVAWLGDTF
5 -> 365 ELIIVLLAIFLGARLGGIGIGFAGGLGVLVLAAIGVKPGNIPFDVISIIMAVIAAISAMQVAGGLDYLVHQTEKLLRRNPKYITILAPIVTYFLTIFAGTGNISLATLPVIAEVAKEQGVKPCRPLSTAVVSAQIAITASPISAAVVYMSSVMEGHGISYLHLLSVVIPSTLLAVLVMSFLVTMLFNSKLSDDPIYRKRLEEGLVELRGEKQIEIKSGAKTSVWLFLLGVVGVVIYAIINSPSMGLVEKPLMNTTNAILIIMLSVATLTTVICKVDTDNILNSSTFKAGMSACICILGVAWLGDTFVSNNIDWIKDTAGEVIQGHPWLLAVIFFFASALLYSQAATAKALMPMALALNVSP
365 -> 367 PLT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015556 - C4-dicarboxylate transmembrane transporter activity
GO:0005469 - succinate:fumarate antiporter activity
biological_process GO:0140009 - L-aspartate import across plasma membrane
GO:0009061 - anaerobic respiration
GO:0044271 - cellular nitrogen compound biosynthetic process
GO:0015740 - C4-dicarboxylate transport
GO:0015741 - fumarate transport
GO:0071422 - succinate transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Engel P., et al., 1992
External database links:  
ECOCYC:
DCUA-MONOMER
ECOLIWIKI:
b4138
INTERPRO:
IPR004668
PANTHER:
PTHR36106
PFAM:
PF03605
PRIDE:
P0ABN5
PRODB:
PRO_000022412
REFSEQ:
NP_418561
UNIPROT:
P0ABN5


Operon      
Name: aspA-dcuA         
Operon arrangement:
Transcription unit        Promoter
dcuA
dcuA
aspA
aspA-dcuA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, DcuR
Repressed by: NarL
Growth Conditions:

[1] 

C:
E: Escherichia coli| L broth| fumarate 50 mM; glycerol 0.4%| oxygen atom| mid exponential phase

[2] 

C: Escherichia coli| M9 minimal medium| casamino acids 0.05%; fumarate 50 mM; glycerol 0.4%| oxygen atom| 37.0 C
E: Escherichia coli| M9 minimal medium| casamino acids 0.05%; fumarate 50 mM; glycerol 0.4%| 37.0 C

[3] 

C:
E: Escherichia coli| L broth| fumarate 50 mM; glycerol 0.4%| mid exponential phase

[4] 

C:
E: Escherichia coli| L broth| fumarate 50 mM; glycerol 0.4%



RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4934 4366101 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4935 4366103 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4936 4366114 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4937 4366119 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4938 4366313 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4939 4366748 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4940 4366806 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4941 (cluster) 4366809 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4942 4366833 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4943 4366838 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4944 4367788 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4945 4367803 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_4946 4368190 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Engel P., Kramer R., Unden G., 1992, Anaerobic fumarate transport in Escherichia coli by an fnr-dependent dicarboxylate uptake system which is different from the aerobic dicarboxylate uptake system., J Bacteriol 174(17):5533-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB