RegulonDB RegulonDB 10.9: Gene Form
   

rhlE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhlE cecR ybiA CecR TSS_959 TSS_959 rhlEp5 rhlEp5 TSS_958 TSS_958 cecRp cecRp TSS_957 TSS_957 TSS_956 TSS_956

Gene      
Name: rhlE    Texpresso search in the literature
Synonym(s): ECK0786, EG11235, b0797
Genome position(nucleotides): 830872 --> 832236 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.7
External database links:  
ASAP:
ABE-0002719
CGSC:
33907
ECHOBASE:
EB1217
ECOLIHUB:
rhlE
OU-MICROARRAY:
b0797
STRING:
511145.b0797
COLOMBOS: rhlE


Product      
Name: ATP-dependent RNA helicase RhlE
Synonym(s): RhlE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 49.989
Isoelectric point: 10.73
Motif(s):
 
Type Positions Sequence
25 -> 196 TPIQQQAIPAVLEGRDLMASAQTGTGKTAGFTLPLLQHLITRQPHAKGRRPVRALILTPTRELAAQIGENVRDYSKYLNIRSLVVFGGVSINPQMMKLRGGVDVLVATPGRLLDLEHQNAVKLDQVEILVLDEADRMLDMGFIHDIRRVLTKLPAKRQNLLFSATFSDDIKA
230 -> 230 K
107 -> 107 L
258 -> 258 A
156 -> 159 DEAD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0004386 - helicase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0000166 - nucleotide binding
GO:0003724 - RNA helicase activity
GO:0005524 - ATP binding
biological_process GO:0009408 - response to heat
GO:0042254 - ribosome biogenesis
GO:0042255 - ribosome assembly
Note(s): Note(s): ...[more].
Reference(s): [1] Tamura M., et al., 2012
[2] Yamanaka Y., et al., 2016
External database links:  
DIP:
DIP-10697N
ECOCYC:
EG11235-MONOMER
ECOLIWIKI:
b0797
INTERPRO:
IPR011545
INTERPRO:
IPR014001
INTERPRO:
IPR014014
INTERPRO:
IPR001650
INTERPRO:
IPR027417
INTERPRO:
IPR028622
INTERPRO:
IPR000629
MODBASE:
P25888
PFAM:
PF00271
PFAM:
PF00270
PRIDE:
P25888
PRODB:
PRO_000023741
PROSITE:
PS51195
PROSITE:
PS51194
PROSITE:
PS51192
PROSITE:
PS00039
REFSEQ:
NP_415318
SMART:
SM00490
SMART:
SM00487
SMR:
P25888
SWISSMODEL:
P25888
UNIPROT:
P25888


Operon      
Name: rhlE         
Operon arrangement:
Transcription unit        Promoter
rhlE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_956 830082 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_957 830088 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_958 830670 reverse nd [RS-EPT-CBR] [3]
  promoter rhlEp5 830783 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_959 830785 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Tamura M., Kers JA., Cohen SN., 2012, Second-site suppression of RNase E essentiality by mutation of the deaD RNA helicase in Escherichia coli., J Bacteriol 194(8):1919-26

 [2] Yamanaka Y., Shimada T., Yamamoto K., Ishihama A., 2016, Transcription factor CecR (YbiH) regulates a set of genes affecting the sensitivity of Escherichia coli against cefoperazone and chloramphenicol., Microbiology 162(7):1253-64

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB