RegulonDB RegulonDB 10.9: Gene Form
   

pdeL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeL yahB yahV Cra Cra pdeLp3 pdeLp3 pdeLp1 pdeLp1 pdeLp2 pdeLp2

Gene      
Name: pdeL    Texpresso search in the literature
Synonym(s): ECK0313, EG11236, b0315, yahA
Genome position(nucleotides): 332371 --> 333459 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.91
External database links:  
ASAP:
ABE-0001086
ECHOBASE:
EB1218
ECOLIHUB:
yahA
OU-MICROARRAY:
b0315
STRING:
511145.b0315
COLOMBOS: pdeL


Product      
Name: DNA-binding transcriptional activator/c-di-GMP phosphodiesterase PdeL
Synonym(s): PdeL, YahA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Molecular weight: 40.725
Isoelectric point: 6.389
Motif(s):
 
Type Positions Sequence
112 -> 346 AISLALENHEFKPWIQPVFCAQTGVLTGCEVLVRWEHPQTGIIPPDQFIPLAESSGLIVIMTRQLMKQTADILMPVKHLLPDNFHIGINVSAGCFLAAGFEKECLNLVNKLGNDKIKLVLELTERNPIPVTPEARAIFDSLHQHNITFALDDFGTGYATYRYLQAFPVDFIKIDKSFVQMASVDEISGHIVDNIVELARKPGLSIVAEGVETQEQADLMIGKGVHFLQGYLYSPP
263 -> 263 D
144 -> 145 VR
299 -> 299 G
18 -> 83 HLSLPGSVSEKERLLLKLLMQGMSVTEISQYRNRSAKTISHQKKQLFEKLGIQSDITFWRDIFFQY

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0042803 - protein homodimerization activity
GO:0071111 - cyclic-guanylate-specific phosphodiesterase activity
GO:0000984 - bacterial-type RNA polymerase transcription regulatory region sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
External database links:  
ECOCYC:
EG11236-MONOMER
ECOLIWIKI:
b0315
INTERPRO:
IPR001633
INTERPRO:
IPR036388
INTERPRO:
IPR035919
INTERPRO:
IPR016032
INTERPRO:
IPR000792
MODBASE:
P21514
PDB:
4KIE
PDB:
4LYK
PDB:
4LJ3
PFAM:
PF00563
PFAM:
PF00196
PRIDE:
P21514
PROSITE:
PS50043
PROSITE:
PS50883
REFSEQ:
NP_414849
SMART:
SM00052
SMART:
SM00421
SMR:
P21514
UNIPROT:
P21514


Operon      
Name: pdeL         
Operon arrangement:
Transcription unit        Promoter
yahA
yahA
pdeL


Transcriptional Regulation      
Display Regulation             
Activated by: PdeL
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB