RegulonDB RegulonDB 10.9: Gene Form
   

yggE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygfI yggE argO och5 scpC yggEp2 yggEp2 yggEp1 yggEp1

Gene      
Name: yggE    Texpresso search in the literature
Synonym(s): ECK2918, EG11244, b2922
Genome position(nucleotides): 3067340 <-- 3068080 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.63
External database links:  
ASAP:
ABE-0009588
ECHOBASE:
EB1225
ECOLIHUB:
yggE
OU-MICROARRAY:
b2922
STRING:
511145.b2922
COLOMBOS: yggE


Product      
Name: DUF541 domain-containing protein YggE
Synonym(s): YggE
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 26.635
Isoelectric point: 6.532
Motif(s):
 
Type Positions Sequence
30 -> 230 IVTSGTASVDAVPDIATLAIEVNVAAKDAATAKKQADERVAQYISFLELNQIAKKDISSANLRTQPDYDYQDGKSILKGYRAVRTVEVTLRQLDKLNSLLDGALKAGLNEIRSVSLGVAQPDAYKDKARKAAIDNAIHQAQELANGFHRKLGPVYSVRYHVSNYQPSPMVRMMKADAAPVSAQETYEQAAIQFDDQVDVVF

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0071575 - integral component of external side of plasma membrane
molecular_function GO:0042802 - identical protein binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0034605 - cellular response to heat
GO:0034614 - cellular response to reactive oxygen species
Note(s): Note(s): ...[more].
Reference(s): [1] Nguyen MH., et al., 2013
[2] Schumann S., et al., 2012
External database links:  
DIP:
DIP-47891N
ECOCYC:
EG11244-MONOMER
ECOLIWIKI:
b2922
INTERPRO:
IPR007497
PFAM:
PF04402
PRIDE:
P0ADS6
REFSEQ:
NP_417397
SMR:
P0ADS6
UNIPROT:
P0ADS6


Operon      
Name: yggE         
Operon arrangement:
Transcription unit        Promoter
yggE
yggE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Nguyen MH., Ojima Y., Kawata T., Taya M., 2013, Alternation in colonization behaviors of Escherichia coli cells with rpoS or yggE deficiency on solid surfaces., Biotechnol Bioeng 110(4):1050-6

 [2] Schumann S., Alpert C., Engst W., Loh G., Blaut M., 2012, Dextran sodium sulfate-induced inflammation alters the expression of proteins by intestinal Escherichia coli strains in a gnotobiotic mouse model., Appl Environ Microbiol 78(5):1513-22


RegulonDB