RegulonDB RegulonDB 10.8: Gene Form
   

rlmH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mrdA rlmH rsfS TSS_760 TSS_760 TSS_759 TSS_759

Gene      
Name: rlmH    Texpresso search in the literature
Synonym(s): ECK0629, EG11254, b0636, ybeA
Genome position(nucleotides): 668248 <-- 668715 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.33
External database links:  
ASAP:
ABE-0002180
ECHOBASE:
EB1234
OU-MICROARRAY:
b0636
PortEco:
rlmH
STRING:
511145.b0636
COLOMBOS: rlmH


Product      
Name: 23S rRNA m3Ψ1915 methyltransferase
Synonym(s): RlmH, YbeA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.341
Isoelectric point: 9.077
Motif(s):
 
Type Positions Sequence
1 -> 153 MKLQLVAVGTKMPDWVQTGFTEYLRRFPKDMPFELIEIPAGKRGKNADIKRILDKEGEQMLAAAGKNRIVTLDIPGKPWDTPQLAAELERWKLDGRDVSLLIGGPEGLSPACKAAAEQSWSLSALTLPHPLVRVLVAESLYRAWSITTNHPYH
142 -> 142 R
152 -> 152 Y
154 -> 154 R
122 -> 127 LSALTL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0043022 - ribosome binding
GO:0042803 - protein homodimerization activity
GO:0070038 - rRNA (pseudouridine-N3-)-methyltransferase activity
biological_process GO:0031167 - rRNA methylation
GO:0006364 - rRNA processing
GO:0032259 - methylation
GO:0070475 - rRNA base methylation
Note(s): Note(s): ...[more].
Reference(s): [1] Sergiev PV., et al., 2012
[2] Xu Y., et al., 2018
External database links:  
DIP:
DIP-11357N
ECOCYC:
EG11254-MONOMER
ECOLIWIKI:
b0636
INTERPRO:
IPR029028
INTERPRO:
IPR029026
INTERPRO:
IPR003742
MINT:
MINT-1251153
MODBASE:
P0A8I8
PANTHER:
PTHR33603
PDB:
5ZYO
PDB:
1NS5
PDB:
5TWK
PDB:
5TWJ
PFAM:
PF02590
PRIDE:
P0A8I8
PRODB:
PRO_000023770
REFSEQ:
NP_415169
SMR:
P0A8I8
UNIPROT:
P0A8I8


Operon      
Name: rsfS-rlmH-mrdAB-rlpA         
Operon arrangement:
Transcription unit        Promoter
rsfS-rlmH-mrdAB-rlpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_759 667132 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_760 668468 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sergiev PV., Golovina AY., Sergeeva OV., Osterman IA., Nesterchuk MV., Bogdanov AA., Dontsova OA., 2012, How much can we learn about the function of bacterial rRNA modification by mining large-scale experimental datasets?, Nucleic Acids Res 40(12):5694-705

 [2] Xu Y., Li S., Yan Z., Luo Z., Ren H., Ge B., Huang F., Yue T., 2018, Stabilizing Effect of Inherent Knots on Proteins Revealed by Molecular Dynamics Simulations., Biophys J 115(9):1681-1689

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB