RegulonDB RegulonDB 10.8: Gene Form
   

iraP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: iraP    Texpresso search in the literature
Synonym(s): ECK0377, EG11256, b0382, yaiB
Genome position(nucleotides): 401386 --> 401646 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.36
External database links:  
ASAP:
ABE-0001313
ECHOBASE:
EB1236
OU-MICROARRAY:
b0382
PortEco:
iraP
STRING:
511145.b0382
COLOMBOS: iraP


Product      
Name: anti-adaptor protein for σS stabilization
Synonym(s): IraP, YaiB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.937
Isoelectric point: 4.546
Motif(s):
 
Type Positions Sequence
9 -> 9 L
1 -> 85 MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQQRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0043856 - anti-sigma factor antagonist activity
biological_process GO:0045893 - positive regulation of transcription, DNA-templated
GO:0009267 - cellular response to starvation
GO:0016036 - cellular response to phosphate starvation
GO:0042177 - negative regulation of protein catabolic process
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Aubee JI., et al., 2016
[2] Bougdour A., et al., 2006
External database links:  
DIP:
DIP-48131N
ECOCYC:
EG11256-MONOMER
ECOLIWIKI:
b0382
INTERPRO:
IPR019732
PFAM:
PF10796
PRIDE:
P0AAN9
PRODB:
PRO_000023030
REFSEQ:
NP_414916
SMR:
P0AAN9
UNIPROT:
P0AAN9


Operon      
Name: iraP         
Operon arrangement:
Transcription unit        Promoter
iraP
iraP


Transcriptional Regulation      
Display Regulation             
Activated by: CsgD


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_495 401433 forward nd [RS-EPT-CBR] [3]



RegulonDB