RegulonDB RegulonDB 10.9: Gene Form
   

dgcC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcC proC psiF CsgD CsgD adrAp adrAp

Gene      
Name: dgcC    Texpresso search in the literature
Synonym(s): ECK0380, EG11257, adrA, b0385, yaiC
Genome position(nucleotides): 403703 --> 404818 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.67
External database links:  
ASAP:
ABE-0001336
ECHOBASE:
EB1237
ECOLIHUB:
adrA
OU-MICROARRAY:
b0385
STRING:
511145.b0385
COLOMBOS: dgcC


Product      
Name: diguanylate cyclase DgcC
Synonym(s): AdrA, DgcC, YaiC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 41.537
Isoelectric point: 9.984
Motif(s):
 
Type Positions Sequence
40 -> 128 RVRLPRAVGLAGMFLPIASTLVSHPPPGWWWLVLVGWAFVWPHLAWQIASRAVDPLSREIYNLKTDAVLAGMWVGVMGVNVLPSTAMLM
46 -> 66 AVGLAGMFLPIASTLVSHPPP
291 -> 292 DE
68 -> 88 WWWLVLVGWAFVWPHLAWQIA
112 -> 132 WVGVMGVNVLPSTAMLMIMCL

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
GO:0052621 - diguanylate cyclase activity
biological_process GO:2001008 - positive regulation of cellulose biosynthetic process
GO:0043709 - cell adhesion involved in single-species biofilm formation
GO:1902201 - negative regulation of bacterial-type flagellum-dependent cell motility
External database links:  
ECOCYC:
EG11257-MONOMER
ECOLIWIKI:
b0385
INTERPRO:
IPR029787
INTERPRO:
IPR007894
INTERPRO:
IPR000160
INTERPRO:
IPR043128
PFAM:
PF00990
PFAM:
PF05230
PRIDE:
P0AAP1
PROSITE:
PS50887
REFSEQ:
NP_414919
SMART:
SM00267
SMR:
P0AAP1
UNIPROT:
P0AAP1


Operon      
Name: dgcC         
Operon arrangement:
Transcription unit        Promoter
adrA


Transcriptional Regulation      
Display Regulation             
Activated by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB