RegulonDB RegulonDB 10.9: Gene Form
   

fmt gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rsmB fmt def rsmBp4 rsmBp4 TSS_3607 TSS_3607

Gene      
Name: fmt    Texpresso search in the literature
Synonym(s): ECK3274, EG11268, b3288, ftm, yhdD
Genome position(nucleotides): 3434214 --> 3435161 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.85
External database links:  
ASAP:
ABE-0010781
CGSC:
33616
ECHOBASE:
EB1247
ECOLIHUB:
fmt
OU-MICROARRAY:
b3288
STRING:
511145.b3288
COLOMBOS: fmt


Product      
Name: 10-formyltetrahydrofolate:L-methionyl-tRNAfMet N-formyltransferase
Synonym(s): Fmt, Ftm, YhdD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.168
Isoelectric point: 5.461
Motif(s):
 
Type Positions Sequence
113 -> 116 SLLP
207 -> 304 KLSKEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSR
6 -> 183 RIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITT
2 -> 189 SESLRIIFAGTPDFAARHLDALLSSGHNVVGVFTQPDRPAGRGKKLMPSPVKVLAEEKGLPVFQPVSLRPQENQQLVAELQADVMVVVAYGLILPKAVLEMPRLGCINVHGSLLPRWRGAAPIQRSLWAGDAETGVTIMQMDVGLDTGDMLYKLSCPITAEDTSGTLYDKLAELGPQGLITTLKQLAD
210 -> 315 KEEARIDWSLSAAQLERCIRAFNPWPMSWLEIEGQPVKVWKASVIDTATNAAPGTILEANKQGIQVATGDGILNLLSLQPAGKKAMSAQDLLNSRREWFVPGNRLV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.5 - tRNA
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016742 - hydroxymethyl-, formyl- and related transferase activity
GO:0004479 - methionyl-tRNA formyltransferase activity
biological_process GO:0006412 - translation
GO:0006413 - translational initiation
GO:0009058 - biosynthetic process
GO:0019988 - charged-tRNA amino acid modification
GO:0071951 - conversion of methionyl-tRNA to N-formyl-methionyl-tRNA
Note(s): Note(s): ...[more].
Reference(s): [1] Lennette ET., et al., 1970
External database links:  
DIP:
DIP-9668N
ECOCYC:
EG11268-MONOMER
ECOLIWIKI:
b3288
INTERPRO:
IPR041711
INTERPRO:
IPR001555
INTERPRO:
IPR037022
INTERPRO:
IPR002376
INTERPRO:
IPR005793
INTERPRO:
IPR005794
INTERPRO:
IPR011034
INTERPRO:
IPR036477
MODBASE:
P23882
PDB:
2FMT
PDB:
1FMT
PFAM:
PF00551
PFAM:
PF02911
PRIDE:
P23882
PRODB:
PRO_000022675
PROSITE:
PS00373
REFSEQ:
NP_417746
SMR:
P23882
UNIPROT:
P23882


Operon      
Name: def-fmt         
Operon arrangement:
Transcription unit        Promoter
def-fmt


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3607 3434950 forward nd [RS-EPT-CBR] [2]
  promoter rsmBp4 3434991 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lennette ET., Apiriaon D., 1970, The level of Fmt-tRNA on ribosomes from streptomycin treated cells., Biochem Biophys Res Commun 41(3):804-11

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB