RegulonDB RegulonDB 10.9: Gene Form
   

glrR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glrK glrR qseG glnB PurR TSS_2847 TSS_2847 TSS_2846 TSS_2846 glnBp3 glnBp3 glnBp2 glnBp2 glnBp1 glnBp1

Gene      
Name: glrR    Texpresso search in the literature
Synonym(s): ECK2551, EG11285, b2554, qseF, yfhA
Genome position(nucleotides): 2687469 <-- 2688803 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.76
External database links:  
ASAP:
ABE-0008400
ECHOBASE:
EB1262
ECOLIHUB:
glrR
OU-MICROARRAY:
b2554
STRING:
511145.b2554
COLOMBOS: glrR


Product      
Name: DNA-binding transcriptional activator GlrR
Synonym(s): GlrR, GlrR response regulator, QseF, YfhA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: EBP
Cellular location: cytosol
Molecular weight: 49.148
Isoelectric point: 6.364
Motif(s):
 
Type Positions Sequence
106 -> 106 K
9 -> 117 LLVDDDPGLLKLLGLRLTSEGYSVVTAESGAEGLRVLNREKVDLVISDLRMDEMDGMQLFAEIQKVQPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDKDALYQAI
136 -> 366 IVTRSPLMLRLLEQARLVAQSDVSVLINGQSGTGKEIFAQAIHNASPRNSKPFIAINCGALPEQLLESELFGHARGAFTGAVSNREGLFQAAEGGTLFLDEIGDMPAPLQVKLLRVLQERKVRPLGSNRDIDINVRIISATHRDLPKAMARGEFREDLYYRLNVVSLKIPALAERTEDIPLLANHLLRQAAERHKPFVRAFSTDAMKRLMTASWPGNVRQLVNVIEQCVAL
7 -> 121 HLLLVDDDPGLLKLLGLRLTSEGYSVVTAESGAEGLRVLNREKVDLVISDLRMDEMDGMQLFAEIQKVQPGMPVIILTAHGSIPDAVAATQQGVFSFLTKPVDKDALYQAIDDAL
164 -> 171 GQSGTGKE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0008134 - transcription factor binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000156 - phosphorelay response regulator activity
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Perez-Rueda E., et al., 2000
[2] Perez-Rueda E., et al., 2004
[3] Reichenbach B., et al., 2009
[4] Yamamoto K., et al., 2005
External database links:  
DIP:
DIP-12044N
ECOCYC:
EG11285-MONOMER
ECOLIWIKI:
b2554
INTERPRO:
IPR009057
INTERPRO:
IPR011006
INTERPRO:
IPR025662
INTERPRO:
IPR025943
INTERPRO:
IPR025944
INTERPRO:
IPR027417
INTERPRO:
IPR002078
INTERPRO:
IPR001789
INTERPRO:
IPR003593
MODBASE:
P0AFU4
PFAM:
PF00158
PFAM:
PF00072
PRIDE:
P0AFU4
PRODB:
PRO_000025109
PROSITE:
PS50110
PROSITE:
PS50045
PROSITE:
PS00688
PROSITE:
PS00676
PROSITE:
PS00675
REFSEQ:
NP_417049
SMART:
SM00382
SMART:
SM00448
SMR:
P0AFU4
UNIPROT:
P0AFU4


Operon      
Name: glrR-glnB         
Operon arrangement:
Transcription unit        Promoter
glnB
glnB
glnB
glrR-glnB
yfhA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2846 2690181 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2847 2690186 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Reichenbach B., Gopel Y., Gorke B., 2009, Dual control by perfectly overlapping sigma 54- and sigma 70- promoters adjusts small RNA GlmY expression to different environmental signals., Mol Microbiol 74(5):1054-70

 [4] Yamamoto K., Hirao K., Oshima T., Aiba H., Utsumi R., Ishihama A., 2005, Functional characterization in vitro of all two-component signal transduction systems from Escherichia coli., J Biol Chem 280(2):1448-56

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB