RegulonDB RegulonDB 10.9: Gene Form
   

wzzE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wecB rfe wzzE wecC TSS_4443 TSS_4443 TSS_4442 TSS_4442 TSS_4441 (cluster) TSS_4441 (cluster) TSS_4440 TSS_4440 TSS_4439 TSS_4439 TSS_4438 TSS_4438

Gene      
Name: wzzE    Texpresso search in the literature
Synonym(s): ECK3777, EG11295, b3785, wzz, yifC
Genome position(nucleotides): 3969031 --> 3970077 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.72
External database links:  
ASAP:
ABE-0012370
ECHOBASE:
EB1272
ECOLIHUB:
wzzE
OU-MICROARRAY:
b3785
STRING:
511145.b3785
COLOMBOS: wzzE


Product      
Name: enterobacterial common antigen polysaccharide co-polymerase
Synonym(s): Wzz, WzzE, YifC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 39.489
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
15 -> 85 NELDIRGLFRTLWAGKLWIIGMGLAFALIALAYTFFARQEWSSTAITDRPTVNMLGGYYSQQQFLRNLDVR
323 -> 343 AFLMIMWGIVGGLIGAGVALT
31 -> 51 LWIIGMGLAFALIALAYTFFA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.4 - enterobacterial common antigen (surface glycolipid)
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  6 - cell structure --> 6.1 - membrane
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0004713 - protein tyrosine kinase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009246 - enterobacterial common antigen biosynthetic process
GO:0018108 - peptidyl-tyrosine phosphorylation
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Barr K., et al., 1999
[2] Kalynych S., et al., 2015
External database links:  
ECOCYC:
EG11295-MONOMER
ECOLIWIKI:
b3785
INTERPRO:
IPR032895
INTERPRO:
IPR003856
PFAM:
PF02706
PRIDE:
P0AG00
PRODB:
PRO_000024227
REFSEQ:
NP_418232
SMR:
P0AG00
UNIPROT:
P0AG00


Operon      
Name: rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM         
Operon arrangement:
Transcription unit        Promoter
rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4438 3968862 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4439 3969127 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4440 3969130 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4441 (cluster) 3969176 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4442 3969944 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4443 3969950 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Barr K., Klena J., Rick PD., 1999, The modality of enterobacterial common antigen polysaccharide chain lengths is regulated by o349 of the wec gene cluster of Escherichia coli K-12., J Bacteriol 181(20):6564-8

 [2] Kalynych S., Cherney M., Bostina M., Rouiller I., Cygler M., 2015, Quaternary structure of WzzB and WzzE polysaccharide copolymerases., Protein Sci 24(1):58-69

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB