RegulonDB RegulonDB 10.9: Gene Form
   

ydbD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydbD pdxI ynbA RcsB-BglJ NsrR terminator anti-terminator anti-anti-terminator ynbAp ynbAp ynbAp5 ynbAp5 ynbAp3 ynbAp3 ydbDp ydbDp

Gene      
Name: ydbD    Texpresso search in the literature
Synonym(s): ECK1400, EG11310, b1407
Genome position(nucleotides): 1475144 --> 1477450 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.48
External database links:  
ASAP:
ABE-0004701
ECHOBASE:
EB1286
ECOLIHUB:
ydbD
OU-MICROARRAY:
b1407
STRING:
511145.b1407
COLOMBOS: ydbD


Product      
Name: DUF2773 domain-containing protein YdbD
Synonym(s): YdbD, protein involved in detoxification of methylglyoxal
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 86.716
Isoelectric point: 5.092
Motif(s):
 
Type Positions Sequence
347 -> 347 L
688 -> 768 ALNNRHTPPAVLAAEIDPEWWIVAMNNPRFPVDVLKARLKRDPLLALELVNPELDLVRQLALNGKTRAIREQAMRKLDELY

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005886 - plasma membrane
biological_process GO:0051595 - response to methylglyoxal
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Kim I., et al., 2007
External database links:  
ECOCYC:
EG11310-MONOMER
ECOLIWIKI:
b1407
INTERPRO:
IPR024497
PFAM:
PF10971
PRIDE:
P25907
REFSEQ:
NP_415925
SMR:
P25907
UNIPROT:
P25907


Operon      
Name: ydbD         
Operon arrangement:
Transcription unit        Promoter
ydbD


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ynbAp3 1477462 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ynbAp5 1477471 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kim I., Kim J., Min B., Lee C., Park C., 2007, Screening of genes related to methylglyoxal susceptibility., J Microbiol 45(4):339-43

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB