RegulonDB RegulonDB 10.9: Gene Form
   

malS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

malS avtA baxL MalT MalT MalT PhoP CRP terminator anti-terminator anti-anti-terminator avtAp avtAp malSp malSp TSS_4172 TSS_4172 baxp7 baxp7 baxp5 baxp5

Gene      
Name: malS    Texpresso search in the literature
Synonym(s): ECK3560, EG11316, b3571
Genome position(nucleotides): 3737497 --> 3739527 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.83
External database links:  
ASAP:
ABE-0011668
CGSC:
17659
ECHOBASE:
EB1292
ECOLIHUB:
malS
OU-MICROARRAY:
b3571
STRING:
511145.b3571
COLOMBOS: malS


Product      
Name: α-amylase
Synonym(s): MalS
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 75.713
Isoelectric point: 5.347
Motif(s):
 
Type Positions Sequence
1 -> 17 MKLAACFLTLLPGFAVA
18 -> 676 ASWTSPGFPAFSEQGTGTFVSHAQLPKGTRPLTLNFDQQCWQPADAIKLNQMLSLQPCSNTPPQWRLFRDGEYTLQIDTRSGTPTLMISIQNAAEPVASLVRECPKWDGLPLTVDVSATFPEGAAVRDYYSQQIAIVKNGQIMLQPAATSNGLLLLERAETDTSAPFDWHNATVYFVLTDRFENGDPSNDQSYGRHKDGMAEIGTFHGGDLRGLTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFDVVMNHTGYATLADMQEYQFGALYLSGDEVKKSLGERWSDWKPAAGQTWHSFNDYINFSDKTGWDKWWGKNWIRTDIGDYDNPGFDDLTMSLAFLPDIKTESTTASGLPVFYKNKMDTHAKAIDGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTEASAALREWKKANPDKALDDKPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAQMDTTWQQMAEKLQGFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESSRPFGPTGSDPLQGTRSDMNWQDVSGKSAASVAHWQKISQFRARHPAIGAGKQTTLLLKQGYGFVREHGDDKVLVVWAGQQ
226 -> 371 GDLRGLTNKLDYLQQLGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTNLDANMGNEADLRTLVDSAHQRGIRILFDVVMNHTGYATLADMQEYQFGALYLSGDEVKKSLGERWSDWKPAAGQTWHSFNDYINFSDKT
440 -> 594 YLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTEASAALREWKKANPDKALDDKPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAQMDTTWQQMAEKLQGFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.4 - polysaccharides
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0103025 - alpha-amylase activity (releasing maltohexaose)
GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004556 - alpha-amylase activity
GO:0005509 - calcium ion binding
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0030980 - alpha-glucan catabolic process
GO:0051692 - cellular oligosaccharide catabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH13
DIP:
DIP-10148N
ECOCYC:
ALPHA-AMYL-PERI-MONOMER
ECOLIWIKI:
b3571
INTERPRO:
IPR006047
INTERPRO:
IPR017853
INTERPRO:
IPR014635
MODBASE:
P25718
PFAM:
PF00128
PRIDE:
P25718
PRODB:
PRO_000023154
REFSEQ:
NP_418028
SMART:
SM00642
UNIPROT:
P25718


Operon      
Name: malS         
Operon arrangement:
Transcription unit        Promoter
malS


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PhoP, MalT


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter baxp5 3737221 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter baxp7 3737234 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4172 3737240 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB