RegulonDB RegulonDB 10.9: Gene Form
   

ygfB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepP ygfB zapA ubiH TSS_3189 TSS_3189 TSS_3188 TSS_3188 ssrSp2 ssrSp2 TSS_3186 TSS_3186 TSS_3185 TSS_3185 zapAp3 zapAp3 TSS_3184 (cluster) TSS_3184 (cluster) ygfBp ygfBp

Gene      
Name: ygfB    Texpresso search in the literature
Synonym(s): ECK2904, EG11323, b2909
Genome position(nucleotides): 3054866 <-- 3055444 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.3
External database links:  
ASAP:
ABE-0009551
ECHOBASE:
EB1299
ECOLIHUB:
ygfB
OU-MICROARRAY:
b2909
STRING:
511145.b2909
COLOMBOS: ygfB


Product      
Name: UPF0149 family protein YgfB
Synonym(s): YgfB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.23
Isoelectric point: 3.961
Motif(s):
 
Type Positions Sequence
12 -> 176 EMNQYLNQQGTGLTPAEMHGLISGMICGGNDDSSWLPLLHDLTNEGMAFGHELAQALRKMHSATSDALQDDGFLFQLYLPDGDDVSVFDRADALAGWVNHFLLGLGVTQPKLDKVTGETGEAIDDLRNIAQLGYDEDEDQEELEMSLEEIIEYVRVAALLCHDTF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Nakahigashi K., et al., 1992
External database links:  
DIP:
DIP-48191N
ECOCYC:
EG11323-MONOMER
ECOLIWIKI:
b2909
INTERPRO:
IPR011978
INTERPRO:
IPR036255
MODBASE:
P0A8C4
PFAM:
PF03695
PRIDE:
P0A8C4
REFSEQ:
NP_417385
SMR:
P0A8C4
SWISSMODEL:
P0A8C4
UNIPROT:
P0A8C4


Operon      
Name: ygfB-pepP-ubiHI         
Operon arrangement:
Transcription unit        Promoter
ygfB-pepP-ubiHI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3184 (cluster) 3055487 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter zapAp3 3055551 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3185 3055639 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3186 3055757 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3188 3055764 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3189 3055899 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Nakahigashi K., Miyamoto K., Nishimura K., Inokuchi H., 1992, Isolation and characterization of a light-sensitive mutant of Escherichia coli K-12 with a mutation in a gene that is required for the biosynthesis of ubiquinone., J Bacteriol 174(22):7352-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB