RegulonDB RegulonDB 10.9: Gene Form
   

nadR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ettA radA nadR TSS_5175 TSS_5175 TSS_5174 TSS_5174 TSS_5173 TSS_5173 TSS_5172 TSS_5172

Gene      
Name: nadR    Texpresso search in the literature
Synonym(s): ECK4382, EG11335, b4390, nadI
Genome position(nucleotides): 4627315 --> 4628547 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.93
External database links:  
ASAP:
ABE-0014397
ECHOBASE:
EB1311
ECOLIHUB:
nadR
OU-MICROARRAY:
b4390
STRING:
511145.b4390
COLOMBOS: nadR


Product      
Name: DNA-binding transcriptional repressor/NMN adenylyltransferase NadR
Synonym(s): NadI, NadR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: HTH_3
Cellular location: inner membrane,cytosol
Molecular weight: 47.346
Isoelectric point: 5.347
Motif(s):
 
Type Positions Sequence
259 -> 261 SAW
70 -> 73 FGKF
7 -> 62 LKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFPRQ
230 -> 410 FVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR
18 -> 37 LQQVADASGMTKGYLSQLLN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.7 - nicotinamide adenine dinucleotide
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:1902503 - adenylyltransferase complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:1902494 - catalytic complex
molecular_function GO:0003677 - DNA binding
GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000309 - nicotinamide-nucleotide adenylyltransferase activity
GO:0050262 - ribosylnicotinamide kinase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
biological_process GO:0010446 - response to alkaline pH
GO:0008152 - metabolic process
GO:0009058 - biosynthetic process
GO:0009435 - NAD biosynthetic process
GO:0019363 - pyridine nucleotide biosynthetic process
GO:0016310 - phosphorylation
GO:0071248 - cellular response to metal ion
GO:0051289 - protein homotetramerization
External database links:  
ECOCYC:
PD04413
ECOLIWIKI:
b4390
INTERPRO:
IPR014729
INTERPRO:
IPR041749
INTERPRO:
IPR038727
INTERPRO:
IPR027417
INTERPRO:
IPR016429
INTERPRO:
IPR010982
INTERPRO:
IPR006417
INTERPRO:
IPR004821
INTERPRO:
IPR001387
MODBASE:
P27278
PFAM:
PF13521
PFAM:
PF01381
PRIDE:
P27278
PROSITE:
PS50943
REFSEQ:
NP_418807
SMART:
SM00530
SMR:
P27278
SWISSMODEL:
P27278
UNIPROT:
P27278


Operon      
Name: serB-radA-nadR         
Operon arrangement:
Transcription unit        Promoter
serB-radA
radA-nadR
serB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5172 4627301 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5173 4627303 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5174 4627723 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5175 4628076 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB