RegulonDB RegulonDB 10.9: Gene Form
   

msyB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: msyB    Texpresso search in the literature
Synonym(s): ECK1037, EG11338, b1051
Genome position(nucleotides): 1113807 <-- 1114181 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.13
External database links:  
ASAP:
ABE-0003567
CGSC:
34718
ECHOBASE:
EB1314
ECOLIHUB:
msyB
OU-MICROARRAY:
b1051
STRING:
511145.b1051
COLOMBOS: msyB


Product      
Name: acidic protein MsyB
Synonym(s): MsyB, acidic protein that suppresses heat sensitivity of a secY mutant
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.259
Isoelectric point: 3.35
Motif(s):
 
Type Positions Sequence
3 -> 124 MYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10265N
ECOCYC:
EG11338-MONOMER
ECOLIWIKI:
b1051
INTERPRO:
IPR025729
PFAM:
PF13984
PRIDE:
P25738
PRODB:
PRO_000023300
REFSEQ:
NP_415569
UNIPROT:
P25738


Operon      
Name: msyB         
Operon arrangement:
Transcription unit        Promoter
msyB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1331 1114212 reverse nd [RS-EPT-CBR] [1]



RegulonDB