RegulonDB RegulonDB 10.9: Gene Form
   

ychE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insH21 ychE oppA5\' ychT Lrp Lrp Fis terminator anti-terminator TSS_1622 (cluster) TSS_1622 (cluster)

Gene      
Name: ychE    Texpresso search in the literature
Synonym(s): ECK1236, EG11342, b1242
Genome position(nucleotides): 1298598 --> 1299245 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.84
External database links:  
ASAP:
ABE-0004168
ECHOBASE:
EB1318
ECOLIHUB:
ychE
OU-MICROARRAY:
b1242
STRING:
511145.b1242
COLOMBOS: ychE


Product      
Name: MarC family putative inner membrane protein YchE
Synonym(s): YchE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 23.521
Isoelectric point: 10.072
Motif(s):
 
Type Positions Sequence
54 -> 74 VAIILWISLFLGDTILQLFGI
9 -> 210 PVYFKFFIGLFALVNPVGIIPVFISMTSYQTAAARNKTNLTANLSVAIILWISLFLGDTILQLFGISIDSFRIAGGILVVTIAMSMISGKLGEDKQNKQEKSETAVRESIGVVPLALPLMAGPGAISSTIVWGTRYHSISYLFGFFVAIALFALCCWGLFRMAPWLVRVLRQTGINVITRIMGLLLMALGIEFIVTGIKGIF
120 -> 140 VVPLALPLMAGPGAISSTIVW
81 -> 101 IAGGILVVTIAMSMISGKLGE
147 -> 167 ISYLFGFFVAIALFALCCWGL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11342-MONOMER
ECOLIWIKI:
b1242
INTERPRO:
IPR002771
PANTHER:
PTHR33508
PFAM:
PF01914
PRIDE:
P25743
REFSEQ:
NP_415758
UNIPROT:
P25743


Operon      
Name: ychE         
Operon arrangement:
Transcription unit        Promoter
ychE


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1622 (cluster) 1299471 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB