RegulonDB RegulonDB 10.8: Gene Form
   

fliE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fliF yedN yedL fliE intG fliG FlhDC CsgD FlhDC CsgD anti-anti-terminator anti-terminator terminator fliFp fliFp fliFp1 fliFp1 fliEp fliEp fliEp1 fliEp1

Gene      
Name: fliE    Texpresso search in the literature
Synonym(s): ECK1935, EG11346, b1937, fla, flaAI, flaN
Genome position(nucleotides): 2012700 <-- 2013014 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.97
External database links:  
ASAP:
ABE-0006447
CGSC:
763
ECHOBASE:
EB1322
OU-MICROARRAY:
b1937
PortEco:
fliE
STRING:
511145.b1937
COLOMBOS: fliE


Product      
Name: flagellar protein FliE
Synonym(s): Fla, FlaN, FliE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell projection
Molecular weight: 11.127
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
18 -> 104 AMSARAQESLPQPTISFAGQLHAALDRISDTQTAARTQAEKFTLGEPGVALNDVMTDMQKASVSMQMGIQVRNKLVAAYQEVMSMQV
2 -> 104 SAIQGIEGVISQLQATAMSARAQESLPQPTISFAGQLHAALDRISDTQTAARTQAEKFTLGEPGVALNDVMTDMQKASVSMQMGIQVRNKLVAAYQEVMSMQV

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0009288 - bacterial-type flagellum
GO:0009425 - bacterial-type flagellum basal body
molecular_function GO:0005198 - structural molecule activity
GO:0003774 - motor activity
biological_process GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0097588 - archaeal or bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [HIFBOWEFCRSOS] Human inference of function based on ortholog with experimental function in closely related strain or species.
Reference(s): [1] Muller V., et al., 1992
[2] Raha M., et al., 1993
[3] Suzuki T., et al., 1981
External database links:  
ECOCYC:
EG11346-MONOMER
ECOLIWIKI:
b1937
INTERPRO:
IPR001624
PANTHER:
PTHR34653
PFAM:
PF02049
PRIDE:
P0A8T5
PRINTS:
PR01006
REFSEQ:
NP_416447
UNIPROT:
P0A8T5


Operon      
Name: fliE         
Operon arrangement:
Transcription unit        Promoter
fliE
fliE


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Muller V., Jones CJ., Kawagishi I., Aizawa S., Macnab RM., 1992, Characterization of the fliE genes of Escherichia coli and Salmonella typhimurium and identification of the FliE protein as a component of the flagellar hook-basal body complex., J Bacteriol 174(7):2298-304

 [2] Raha M., Kihara M., Kawagishi I., Macnab RM., 1993, Organization of the Escherichia coli and Salmonella typhimurium chromosomes between flagellar regions IIIa and IIIb, including a large non-coding region., J Gen Microbiol 139(7):1401-7

 [3] Suzuki T., Komeda Y., 1981, Incomplete flagellar structures in Escherichia coli mutants., J Bacteriol 145(2):1036-41


RegulonDB