RegulonDB RegulonDB 10.9: Gene Form
   

amiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mutL amiB tsaE nnr miaA miaAp1 miaAp1 miaAp2 miaAp2 TSS_5013 TSS_5013 mutLp1 mutLp1 mutLp2 mutLp2 TSS_5011 TSS_5011

Gene      
Name: amiB    Texpresso search in the literature
Synonym(s): ECK4165, EG11363, b4169, yjeD
Genome position(nucleotides): 4396065 --> 4397402 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.08
External database links:  
ASAP:
ABE-0013653
CGSC:
34432
ECHOBASE:
EB1338
ECOLIHUB:
amiB
OU-MICROARRAY:
b4169
STRING:
511145.b4169
COLOMBOS: amiB


Product      
Name: N-acetylmuramoyl-L-alanine amidase B
Synonym(s): AmiB, N-acetylmuramoyl-L-alanine amidase 2, YjeD
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 47.985
Isoelectric point: 9.75
Motif(s):
 
Type Positions Sequence
269 -> 269 H
1 -> 22 MMYRIRNWLVATLLLLCTPVGA
382 -> 382 E
200 -> 200 H
194 -> 413 IAIDAGHGGQDPGAIGPGGTREKNVTIAIARKLRTLLNDDPMFKGVLTRDGDYFISVMGRSDVARKQNANFLVSIHADAAPNRSATGASVWVLSNRRANSEMASWLEQHEKQSELLGGAGDVLANSQSDPYLSQAVLDLQFGHSQRVGYDVATSMISQLQRIGEIHKRRPEHASLGVLRSPDIPSVLVETGFISNNSEERLLASDDYQQQLAEAIYKGLR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0008745 - N-acetylmuramoyl-L-alanine amidase activity
biological_process GO:0051301 - cell division
GO:0043093 - FtsZ-dependent cytokinesis
GO:0009253 - peptidoglycan catabolic process
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Heidrich C., et al., 2002
[2] Parquet C., et al., 1983
[3] Tsui HC., et al., 1994
[4] van Heijenoort J., et al., 1975
External database links:  
ECOCYC:
NACMURLALAAMI2-MONOMER
ECOLIWIKI:
b4169
INTERPRO:
IPR002508
MODBASE:
P26365
PFAM:
PF01520
PRIDE:
P26365
REFSEQ:
NP_418590
SMART:
SM00646
SMR:
P26365
SWISSMODEL:
P26365
UNIPROT:
P26365


Operon      
Name: nnr-tsaE-amiB-mutL-miaA-hfq-hflXKC         
Operon arrangement:
Transcription unit        Promoter
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
yjeFE-amiB-mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
mutL-miaA-hfq-hflXKC
miaA-hfq-hflXKC
miaA-hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
hfq-hflXKC
tsaE-amiB-mutL-miaA-hfq-hflXKC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5011 4395713 forward nd [RS-EPT-CBR] [5]
  promoter TSS_5013 4398332 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Heidrich C., Ursinus A., Berger J., Schwarz H., Holtje JV., 2002, Effects of multiple deletions of murein hydrolases on viability, septum cleavage, and sensitivity to large toxic molecules in Escherichia coli., J Bacteriol 184(22):6093-9

 [2] Parquet C., Flouret B., Leduc M., Hirota Y., van Heijenoort J., 1983, N-acetylmuramoyl-L-alanine amidase of Escherichia coli K12. Possible physiological functions., Eur J Biochem 133(2):371-7

 [3] Tsui HC., Zhao G., Feng G., Leung HC., Winkler ME., 1994, The mutL repair gene of Escherichia coli K-12 forms a superoperon with a gene encoding a new cell-wall amidase., Mol Microbiol 11(1):189-202

 [4] van Heijenoort J., Parquet C., Flouret B., van Heijenoort Y., 1975, Envelope-bound N-acetylmuramyl-L-alanine amidase of Escherichia coli K 12. Purification and properties of the enzyme., Eur J Biochem 58(2):611-9

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB