RegulonDB RegulonDB 10.9: Gene Form
   

ubiC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjbI malM ubiA ubiC FNR IHF TSS_4876 TSS_4876 ubiCp ubiCp

Gene      
Name: ubiC    Texpresso search in the literature
Synonym(s): ECK4031, EG11369, b4039
Genome position(nucleotides): 4252506 --> 4253003 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.81
Reference(s): [1] Nichols BP., et al., 1992
External database links:  
ASAP:
ABE-0013227
CGSC:
48
ECHOBASE:
EB1343
ECOLIHUB:
ubiC
OU-MICROARRAY:
b4039
STRING:
511145.b4039
COLOMBOS: ubiC


Product      
Name: chorismate lyase
Synonym(s): UbiC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.777
Isoelectric point: 8.2
Motif(s):
 
Type Positions Sequence
17 -> 165 EIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY
2 -> 165 SHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY
91 -> 91 G
156 -> 156 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0008813 - chorismate lyase activity
biological_process GO:0006744 - ubiquinone biosynthetic process
GO:0042866 - pyruvate biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [2] Anand A., et al., 2019
[3] Barker JL., et al., 2001
[4] Heide L., et al., 1993
[5] Nishimura K., et al., 1992
[6] Xie LX., et al., 2015
External database links:  
DIP:
DIP-11066N
ECOCYC:
CHORPYRLY-MONOMER
ECOLIWIKI:
b4039
INTERPRO:
IPR028978
INTERPRO:
IPR007440
MODBASE:
P26602
PANTHER:
PTHR38683
PDB:
2AHC
PDB:
1G81
PDB:
1XLR
PDB:
1FW9
PDB:
1G1B
PDB:
1JD3
PDB:
1TT8
PFAM:
PF04345
PRIDE:
P26602
PRODB:
PRO_000024156
REFSEQ:
NP_418463
SMR:
P26602
UNIPROT:
P26602


Operon      
Name: ubiCA         
Operon arrangement:
Transcription unit        Promoter
ubiCA


Transcriptional Regulation      
Display Regulation             
Repressed by: FNR, IHF, NarL, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4876 4252748 forward nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nichols BP., Green JM., 1992, Cloning and sequencing of Escherichia coli ubiC and purification of chorismate lyase., J Bacteriol 174(16):5309-16

 [2] Anand A., Chen K., Yang L., Sastry AV., Olson CA., Poudel S., Seif Y., Hefner Y., Phaneuf PV., Xu S., Szubin R., Feist AM., Palsson BO., 2019, Adaptive evolution reveals a tradeoff between growth rate and oxidative stress during naphthoquinone-based aerobic respiration., Proc Natl Acad Sci U S A 116(50):25287-25292

 [3] Barker JL., Frost JW., 2001, Microbial synthesis of p-hydroxybenzoic acid from glucose., Biotechnol Bioeng 76(4):376-90

 [4] Heide L., Melzer M., Siebert M., Bechthold A., Schroder J., Severin K., 1993, Clarification of the Escherichia coli genetic map in the 92-minute region containing the ubiCA operon and the plsB, dgk, lexA, and dinF genes., J Bacteriol 175(17):5728-9

 [5] Nishimura K., Nakahigashi K., Inokuchi H., 1992, Location of the ubiA gene on the physical map of Escherichia coli., J Bacteriol 174(17):5762

 [6] Xie LX., Williams KJ., He CH., Weng E., Khong S., Rose TE., Kwon O., Bensinger SJ., Marbois BN., Clarke CF., 2015, Resveratrol and para-coumarate serve as ring precursors for coenzyme Q biosynthesis., J Lipid Res 56(4):909-19

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB