RegulonDB RegulonDB 10.9: Gene Form
   

folE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeiB yeiG folE MetJ MetJ MetJ MetJ yeiGp6 yeiGp6 TSS_2458 (cluster) TSS_2458 (cluster) folEp folEp TSS_2457 TSS_2457 TSS_2456 TSS_2456 yeiBp2 yeiBp2

Gene      
Name: folE    Texpresso search in the literature
Synonym(s): ECK2146, EG11375, b2153
Genome position(nucleotides): 2242984 <-- 2243652 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.27
External database links:  
ASAP:
ABE-0007117
CGSC:
32718
ECHOBASE:
EB1349
ECOLIHUB:
folE
MIM:
128230
MIM:
233910
OU-MICROARRAY:
b2153
STRING:
511145.b2153
COLOMBOS: folE


Product      
Name: GTP cyclohydrolase 1
Synonym(s): FolE, GTP cyclohydrolase I
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.831
Isoelectric point: 7.366
Motif(s):
 
Type Positions Sequence
2 -> 222 PSLSKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSLMETPHRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHHN
41 -> 218 AGHMTEIMQLLNLDLADDSLMETPHRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0003934 - GTP cyclohydrolase I activity
GO:0000166 - nucleotide binding
GO:0005525 - GTP binding
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0006730 - one-carbon metabolic process
GO:0046654 - tetrahydrofolate biosynthetic process
GO:0006729 - tetrahydrobiopterin biosynthetic process
GO:0008616 - queuosine biosynthetic process
GO:0035998 - 7,8-dihydroneopterin 3'-triphosphate biosynthetic process
External database links:  
DIP:
DIP-9676N
ECOCYC:
GTP-CYCLOHYDRO-I-MONOMER
ECOLIWIKI:
b2153
ECOO157CYC:
FOLE-MONOMER
INTERPRO:
IPR001474
INTERPRO:
IPR020602
INTERPRO:
IPR043133
INTERPRO:
IPR043134
INTERPRO:
IPR018234
MINT:
P0A6T5
PANTHER:
PTHR11109
PDB:
1N3T
PDB:
1N3S
PDB:
1N3R
PDB:
1GTP
PDB:
1FBX
PDB:
1A9C
PDB:
1A8R
PFAM:
PF01227
PRIDE:
P0A6T5
PROSITE:
PS00859
PROSITE:
PS00860
REFSEQ:
NP_416658
SMR:
P0A6T5
UNIPROT:
P0A6T5


Operon      
Name: folE-yeiB         
Operon arrangement:
Transcription unit        Promoter
folE-yeiB


Transcriptional Regulation      
Display Regulation             
Repressed by: MetJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeiBp2 2243073 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2456 2243404 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2457 2243799 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2458 (cluster) 2243879 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter yeiGp6 2243888 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB