RegulonDB RegulonDB 10.9: Gene Form
   

sufA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sufB sufA rydB OxyR OxyR IHF IscR IscR NsrR IscR Fur NsrR sufAp sufAp

Gene      
Name: sufA    Texpresso search in the literature
Synonym(s): ECK1680, EG11378, b1684, ydiC
Genome position(nucleotides): 1764018 <-- 1764386 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.39
External database links:  
ASAP:
ABE-0005624
ECHOBASE:
EB1352
ECOLIHUB:
sufA
OU-MICROARRAY:
b1684
STRING:
511145.b1684
COLOMBOS: sufA


Product      
Name: iron-sulfur cluster insertion protein SufA
Synonym(s): Fe-S transport protein in Fe-S cluster assembly, SufA, YdiC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.3
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
18 -> 118 LTLTPAAAIHIRELVAKQPGMVGVRLGVKQTGCAGFGYVLDSVSEPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.19 - incorporation of metal ions
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005198 - structural molecule activity
GO:0005515 - protein binding
GO:0051536 - iron-sulfur cluster binding
GO:0051537 - 2 iron, 2 sulfur cluster binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006979 - response to oxidative stress
GO:0016226 - iron-sulfur cluster assembly
GO:0097428 - protein maturation by iron-sulfur cluster transfer
External database links:  
ECOCYC:
EG11378-MONOMER
ECOLIWIKI:
b1684
INTERPRO:
IPR000361
INTERPRO:
IPR035903
INTERPRO:
IPR017870
INTERPRO:
IPR016092
INTERPRO:
IPR011298
MODBASE:
P77667
PDB:
2D2A
PFAM:
PF01521
PRIDE:
P77667
PRODB:
PRO_000024006
PROSITE:
PS01152
REFSEQ:
NP_416199
SMR:
P77667
UNIPROT:
P77667


Operon      
Name: sufABCDSE         
Operon arrangement:
Transcription unit        Promoter
sufABCDSE


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, IscR, OxyR
Repressed by: NsrR, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB