RegulonDB RegulonDB 10.10: Gene Form
   

ahpF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ahpF ahpC uspG MetJ terminator anti-terminator TSS_744 TSS_744 TSS_743 (cluster) TSS_743 (cluster) TSS_742 TSS_742 TSS_741 TSS_741 TSS_740 TSS_740 TSS_739 TSS_739 ahpFp ahpFp TSS_738 TSS_738 TSS_737 TSS_737

Gene      
Name: ahpF    Texpresso search in the literature
Synonym(s): ECK0600, EG11385, b0606
Genome position(nucleotides): 639753 --> 641318 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.13
External database links:  
ASAP:
ABE-0002093
CGSC:
31194
ECHOBASE:
EB1358
ECOLIHUB:
ahpF
OU-MICROARRAY:
b0606
STRING:
511145.b0606
COLOMBOS: ahpF


Product      
Name: alkyl hydroperoxide reductase, AhpF component
Synonym(s): AhpF, alkyl hydroperoxide reductase, F52a subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 56.177
Isoelectric point: 5.397
Motif(s):
 
Type Positions Sequence
213 -> 499 YDVLIVGSGPAGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIII
214 -> 229 DVLIVGSGPAGAAAAI
357 -> 371 RVAVIGGGNSGVEAA
126 -> 195 SLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKEFGQGRMTLTEIVAKI
478 -> 488 TNVKGVFAAGD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009321 - alkyl hydroperoxide reductase complex
molecular_function GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0015035 - protein-disulfide reductase activity
GO:0051287 - NAD binding
GO:0071949 - FAD binding
GO:0008785 - alkyl hydroperoxide reductase activity
biological_process GO:0000302 - response to reactive oxygen species
Note(s): Note(s): ...[more].
Reference(s): [1] Gomez-Sagasti MT., et al., 2014
[2] Ling J., et al., 2012
[3] Satoh J., et al., 2020
[4] Smillie DA., et al., 1992
External database links:  
DIP:
DIP-9077N
ECOCYC:
EG11385-MONOMER
ECOLIWIKI:
b0606
INTERPRO:
IPR002109
INTERPRO:
IPR036249
INTERPRO:
IPR036188
INTERPRO:
IPR008255
INTERPRO:
IPR012081
INTERPRO:
IPR012336
INTERPRO:
IPR023753
MODBASE:
P35340
PDB:
4YKG
PDB:
4YKF
PDB:
4XVG
PDB:
4O5U
PDB:
4O5Q
PDB:
1FL2
PFAM:
PF07992
PFAM:
PF13192
PRIDE:
P35340
PRODB:
PRO_000022071
PROSITE:
PS51354
PROSITE:
PS00573
REFSEQ:
NP_415139
SMR:
P35340
SWISSMODEL:
P35340
UNIPROT:
P35340


Operon      
Name: ahpCF         
Operon arrangement:
Transcription unit        Promoter
ahpCF
ahpCF
ahpF


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: MetJ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_737 638966 forward nd [RS-EPT-CBR] [5]
  promoter TSS_738 638974 forward nd [RS-EPT-CBR] [5]
  promoter TSS_739 639004 forward nd [RS-EPT-CBR] [5]
  promoter TSS_740 639027 forward nd [RS-EPT-CBR] [5]
  promoter TSS_741 639070 forward nd [RS-EPT-CBR] [5]
  promoter TSS_742 639766 forward nd [RS-EPT-CBR] [5]
  promoter TSS_743 (cluster) 640123 forward nd [RS-EPT-CBR] [5]
  promoter TSS_744 640189 forward nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gomez-Sagasti MT., Becerril JM., Martin I., Epelde L., Garbisu C., 2014, cDNA microarray assessment of early gene expression profiles in Escherichia coli cells exposed to a mixture of heavy metals., Cell Biol Toxicol 30(4):207-32

 [2] Ling J., Cho C., Guo LT., Aerni HR., Rinehart J., Soll D., 2012, Protein aggregation caused by aminoglycoside action is prevented by a hydrogen peroxide scavenger., Mol Cell 48(5):713-22

 [3] Satoh J., Kimata S., Nakamoto S., Ishii T., Tanaka E., Yumoto S., Takeda K., Yoshimura E., Kanesaki Y., Ishige T., Tanaka K., Abe A., Kawasaki S., Niimura Y., 2020, Free flavins accelerate release of ferrous iron from iron storage proteins by both free flavin-dependent and -independent ferric reductases in Escherichia coli., J Gen Appl Microbiol 65(6):308-315

 [4] Smillie DA., Hayward RS., Suzuki T., Fujita N., Ishihama A., 1992, Locations of genes encoding alkyl hydroperoxide reductase on the physical map of the Escherichia coli K-12 genome., J Bacteriol 174(11):3826-7

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB