RegulonDB RegulonDB 10.9: Gene Form
   

fliT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

amyA fliD fliS fliT TSS_2266 TSS_2266 amyAp amyAp

Gene      
Name: fliT    Texpresso search in the literature
Synonym(s): ECK1925, EG11389, b1926
Genome position(nucleotides): 2005713 --> 2006078 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.64
External database links:  
ASAP:
ABE-0006411
CGSC:
30739
ECHOBASE:
EB1362
ECOLIHUB:
fliT
OU-MICROARRAY:
b1926
STRING:
511145.b1926
COLOMBOS: fliT


Shine dalgarno      
Sequence: tctttgattcAGGACCcagtctgATG


Product      
Name: flagellar biosynthesis protein FliT
Synonym(s): FliT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.829
Isoelectric point: 4.431
Motif(s):
 
Type Positions Sequence
21 -> 106 MLRLATEEQWDELIASEMAYVNAVQEIAHLTEEVDPSTTMQEQLRPMLRLILDNESKVKQLLQIRMDELAKLVGQSSVQKSVLSAY
60 -> 98 MQEQLRPMLRLILDNESKVKQLLQIRMDELAKLVGQSSV
1 -> 50 MNHAPHLYFAWQQLVEKSQLMLRLATEEQWDELIASEMAYVNAVQEIAHL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0006457 - protein folding
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0044781 - bacterial-type flagellum organization
GO:1902209 - negative regulation of bacterial-type flagellum assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Kawagishi I., et al., 1992
External database links:  
ECOCYC:
EG11389-MONOMER
ECOLIWIKI:
b1926
INTERPRO:
IPR008622
PFAM:
PF05400
PRIDE:
P0ABY2
PRODB:
PRO_000022669
REFSEQ:
NP_416436
SMR:
P0ABY2
UNIPROT:
P0ABY2


Operon      
Name: fliDST         
Operon arrangement:
Transcription unit        Promoter
fliDST
fliDST


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2266 2006132 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kawagishi I., Muller V., Williams AW., Irikura VM., Macnab RM., 1992, Subdivision of flagellar region III of the Escherichia coli and Salmonella typhimurium chromosomes and identification of two additional flagellar genes., J Gen Microbiol 138 ( Pt 6):1051-65

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB