RegulonDB RegulonDB 10.8: Gene Form
   

ppx gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ppx    Texpresso search in the literature
Synonym(s): ECK2498, EG11403, b2502
Genome position(nucleotides): 2625115 --> 2626656 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.17
External database links:  
ASAP:
ABE-0008238
CGSC:
32899
ECHOBASE:
EB1375
OU-MICROARRAY:
b2502
PortEco:
ppx
STRING:
511145.b2502
COLOMBOS: ppx


Product      
Name: exopolyphosphatase
Synonym(s): Ppx
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 58.136
Isoelectric point: 7.146
Motif(s):
 
Type Positions Sequence
121 -> 121 E
371 -> 371 E
26 -> 308 VIARVVDGAMQIIGRLKQRVHLADGLGPDNMLSEEAMTRGLNCLSLFAERLQGFSPASVCIVGTHTLRQALNATDFLKRAEKVIPYPIEIISGNEEARLIFMGVEHTQPEKGRKLVIDIGGGSTELVIGENFEPILVESRRMGCVSFAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQGWNVAMGASGTIKAAHEVLMEMGEKDGIITPERLEKLVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRELRLSDGALREGVLYEMEGR
143 -> 143 D
150 -> 150 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0016787 - hydrolase activity
GO:0016462 - pyrophosphatase activity
GO:0004309 - exopolyphosphatase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006793 - phosphorus metabolic process
GO:0006798 - polyphosphate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Grillo-Puertas M., et al., 2014
[2] Keasling JD. 1997
[3] Marques CN., et al., 2014
[4] Reizer J., et al., 1993
[5] Saito K., et al., 2005
[6] Van Dien SJ., et al., 1998
[7] Van Dien SJ., et al., 1999
External database links:  
DIP:
DIP-29140N
ECOCYC:
PPX-MONOMER
ECOLIWIKI:
B2502
INTERPRO:
IPR003695
INTERPRO:
IPR030673
INTERPRO:
IPR022371
MINT:
MINT-1285895
PANTHER:
PTHR30005:SF8
PDB:
1U6Z
PFAM:
PF02541
PRIDE:
P0AFL6
PRODB:
PRO_000023584
REFSEQ:
NP_416997
SMR:
P0AFL6
SWISSMODEL:
P0AFL6
UNIPROT:
P0AFL6


Operon      
Name: ppk-ppx         
Operon arrangement:
Transcription unit        Promoter
ppk-ppx
ppk-ppx


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2781 (cluster) 2625007 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]
  promoter TSS_2782 (cluster) 2625014 forward For this promoter, there
Read more >
[RS-EPT-CBR] [8]


Reference(s)    

 [1] Grillo-Puertas M., Schurig-Briccio LA., Rodriguez-Montelongo L., Rintoul MR., Rapisarda VA., 2014, Copper tolerance mediated by polyphosphate degradation and low-affinity inorganic phosphate transport system in Escherichia coli., BMC Microbiol 14:72

 [2] Keasling JD., 1997, Regulation of intracellular toxic metals and other cations by hydrolysis of polyphosphate., Ann N Y Acad Sci 829:242-9

 [3] Marques CN., Morozov A., Planzos P., Zelaya HM., 2014, The fatty acid signaling molecule cis-2-decenoic acid increases metabolic activity and reverts persister cells to an antimicrobial-susceptible state., Appl Environ Microbiol 80(22):6976-91

 [4] Reizer J., Reizer A., Saier MH., Bork P., Sander C., 1993, Exopolyphosphate phosphatase and guanosine pentaphosphate phosphatase belong to the sugar kinase/actin/hsp 70 superfamily., Trends Biochem Sci 18(7):247-8

 [5] Saito K., Ohtomo R., Kuga-Uetake Y., Aono T., Saito M., 2005, Direct labeling of polyphosphate at the ultrastructural level in Saccharomyces cerevisiae by using the affinity of the polyphosphate binding domain of Escherichia coli exopolyphosphatase., Appl Environ Microbiol 71(10):5692-701

 [6] Van Dien SJ., Keasling JD., 1998, Optimization of polyphosphate degradation and phosphate secretion using hybrid metabolic pathways and engineered host strains, Biotechnol Bioeng 59(6):754-61

 [7] Van Dien SJ., Keasling JD., 1999, Effect of polyphosphate metabolism on the Escherichia coli phosphate-starvation response., Biotechnol Prog 15(4):587-93

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB