RegulonDB RegulonDB 10.8: Gene Form
   

ribC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtK cfa ribC terminator anti-terminator anti-anti-terminator TSS_1954 TSS_1954 ribCp5 ribCp5 mdtKp9 mdtKp9 TSS_1953 TSS_1953 mdtKp10 mdtKp10 TSS_1952 TSS_1952 TSS_1951 TSS_1951 TSS_1950 TSS_1950

Gene      
Name: ribC    Texpresso search in the literature
Synonym(s): ECK1658, EG11406, b1662, ribE
Genome position(nucleotides): 1742601 <-- 1743242 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.51
External database links:  
ASAP:
ABE-0005557
CGSC:
11923
ECHOBASE:
EB1378
OU-MICROARRAY:
b1662
PortEco:
ribC
STRING:
511145.b1662
COLOMBOS: ribC


Product      
Name: riboflavin synthase
Synonym(s): RibC, RibE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.445
Isoelectric point: 5.881
Motif(s):
 
Type Positions Sequence
101 -> 103 GHI
3 -> 87 TGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVSFDLMKETLRITNLGDLKVGDWVNVERA
4 -> 6 GIV
62 -> 67 DLMKET
100 -> 185 SGHIMTTAEVAKILTSENNRQIWFKVQDSQLMKYILYKGFIGIDGISLTVGEVTPTRFCVHLIPETLERTTLGKKKLGARVNIEID

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.9 - riboflavin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004746 - riboflavin synthase activity
GO:0016740 - transferase activity
biological_process GO:0009231 - riboflavin biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47865N
ECOCYC:
RIBOFLAVIN-SYN-MONOMER
ECOLIWIKI:
b1662
INTERPRO:
IPR026017
INTERPRO:
IPR023366
INTERPRO:
IPR017938
INTERPRO:
IPR001783
MODBASE:
P0AFU8
PANTHER:
PTHR21098
PDB:
1PKV
PDB:
1I8D
PDB:
1HZE
PDB:
1I18
PFAM:
PF00677
PRIDE:
P0AFU8
PRODB:
PRO_000023753
PROSITE:
PS51177
REFSEQ:
NP_416179
SMR:
P0AFU8
SWISSMODEL:
P0AFU8
UNIPROT:
P0AFU8


Operon      
Name: ribC         
Operon arrangement:
Transcription unit        Promoter
ribC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1950 1741595 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1951 1741685 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1952 1741975 forward nd [RS-EPT-CBR] [1]
  promoter mdtKp10 1743269 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1953 1743275 reverse nd [RS-EPT-CBR] [1]
  promoter mdtKp9 1743375 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ribCp5 1743458 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1954 1744638 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB