RegulonDB RegulonDB 10.9: Gene Form
   

lpxK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaI msbA ycaQ lpxK TSS_1189 TSS_1189

Gene      
Name: lpxK    Texpresso search in the literature
Synonym(s): ECK0906, EG11409, b0915, ycaH
Genome position(nucleotides): 968366 --> 969352 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.71
External database links:  
ASAP:
ABE-0003115
ECHOBASE:
EB1381
ECOLIHUB:
lpxK
OU-MICROARRAY:
b0915
STRING:
511145.b0915
COLOMBOS: lpxK


Product      
Name: tetraacyldisaccharide 4'-kinase
Synonym(s): LpxK, YcaH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 35.589
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
55 -> 62 TAGGNGKT
13 -> 319 WRLLLPLSWLYGLVSGAIRLCYKLKLKRAWRAPVPVVVVGNLTAGGNGKTPVVVWLVEQLQQRGIRVGVVSRGYGGKAESYPLLLSADTTTAQAGDEPVLIYQRTDAPVAVSPVRSDAVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGVRRFGNGWWLPAGPMRERAGRLKSVDAVIVNGGVPRSGEIPMHLLPGQAVNLRTGTRCDVAQLEHVVAMAGIGHPPRFFATLKMCGVQPEKCVPLADHQSLNHADVSALVSAGQTLVMTEKDAVKCRAFAEENWWYLPVDAQLSGDEPAKLLT
158 -> 158 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.3 - lipid A
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.5 - K antigen
  6 - cell structure --> 6.1 - membrane
  6 - cell structure --> 6.2 - murein
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
  6 - cell structure --> 6.7 - capsule (M and K antigens)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0009029 - tetraacyldisaccharide 4'-kinase activity
biological_process GO:0006629 - lipid metabolic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Hampton RY., et al., 1992
External database links:  
DIP:
DIP-10126N
ECOCYC:
TETRAACYLDISACC4KIN-MONOMER
ECOLIWIKI:
b0915
INTERPRO:
IPR003758
INTERPRO:
IPR027417
PANTHER:
PTHR42724
PFAM:
PF02606
PRIDE:
P27300
PRODB:
PRO_000023125
REFSEQ:
NP_415435
SMR:
P27300
UNIPROT:
P27300


Operon      
Name: ycaI-msbA-lpxK-ycaQ         
Operon arrangement:
Transcription unit        Promoter
ycaI-msbA-lpxK-ycaQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1189 966594 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hampton RY., Raetz CR., 1992, Lipid A 4'-kinase from Escherichia coli: enzyme assay and preparation of 4'-32P-labeled probes of high specific radioactivity., Methods Enzymol 209:466-75

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB