RegulonDB RegulonDB 10.8: Gene Form
   

glnD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glnD dapD map anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator TSS_310 TSS_310 glnDp glnDp dapDp dapDp

Gene      
Name: glnD    Texpresso search in the literature
Synonym(s): ECK0165, EG11411, b0167, glnD5
Genome position(nucleotides): 185978 <-- 188650 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.95
External database links:  
ASAP:
ABE-0000568
CGSC:
704
ECHOBASE:
EB1383
OU-MICROARRAY:
b0167
PortEco:
glnD
STRING:
511145.b0167
COLOMBOS: glnD


Product      
Name: PII uridylyltransferase / uridylyl removing enzyme
Synonym(s): GlnD, UTase/UR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 102.39
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
47 -> 47 L
1 -> 349 MNTLPEQYANTALPTLPGQPQNPCVWPRDELTVGGIKAHIDTFQRWLGDAFDNGISAEQLIEARTEFIDQLLQRLWIEAGFSQIADLALVAVGGYGRGELHPLSDVDLLILSRKKLPDDQAQKVGELLTLLWDVKLEVGHSVRTLEECMLEGLSDLTVATNLIESRLLIGDVALFLELQKHIFSEGFWPSDKFYAAKVEEQNQRHQRYHGTSYNLEPDIKSSPGGLRDIHTLQWVARRHFGATSLDEMVGFGFLTSAERAELNECLHILWRIRFALHLVVSRYDNRLLFDRQLSVAQRLNYSGEGNEPVERMMKDYFRVTRRVSELNQMLLQLFDEAILALPADEKPRP
86 -> 137 DLALVAVGGYGRGELHPLSDVDLLILSRKKLPDDQAQKVGELLTLLWDVKLE
93 -> 93 G
703 -> 703 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.2 - glutamine
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0008081 - phosphoric diester hydrolase activity
GO:0008773 - [protein-PII] uridylyltransferase activity
biological_process GO:0008152 - metabolic process
GO:0006464 - cellular protein modification process
GO:0006807 - nitrogen compound metabolic process
GO:0006808 - regulation of nitrogen utilization
Note(s): Note(s): ...[more].
Reference(s): [1] Adler SP., et al., 1975
[2] Atkinson MR., et al., 1994
[3] Kamberov ES., et al., 1995
[4] Magasanik B., et al., 1985
[5] Rhee SG., et al., 1985
[6] Tondervik A., et al., 2006
External database links:  
DIP:
DIP-9779N
ECOCYC:
GLND-MONOMER
ECOLIWIKI:
b0167
INTERPRO:
IPR003607
INTERPRO:
IPR013546
INTERPRO:
IPR010043
INTERPRO:
IPR006674
INTERPRO:
IPR002934
INTERPRO:
IPR002912
MINT:
MINT-1252261
MODBASE:
P27249
PANTHER:
PTHR47320
PFAM:
PF01966
PFAM:
PF08335
PFAM:
PF01909
PFAM:
PF01842
PRIDE:
P27249
PRODB:
PRO_000022784
PROSITE:
PS51831
PROSITE:
PS51671
REFSEQ:
NP_414709
SMART:
SM00471
SMR:
P27249
UNIPROT:
P27249


Operon      
Name: map-glnD-dapD         
Operon arrangement:
Transcription unit        Promoter
dapD
glnD
 


Transcriptional Regulation      
Display Regulation             
Activated by: FNR
Repressed by: Fur, FNR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_310 189471 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Adler SP., Purich D., Stadtman ER., 1975, Cascade control of Escherichia coli glutamine synthetase. Properties of the PII regulatory protein and the uridylyltransferase-uridylyl-removing enzyme., J Biol Chem 250(16):6264-72

 [2] Atkinson MR., Kamberov ES., Weiss RL., Ninfa AJ., 1994, Reversible uridylylation of the Escherichia coli PII signal transduction protein regulates its ability to stimulate the dephosphorylation of the transcription factor nitrogen regulator I (NRI or NtrC)., J Biol Chem 269(45):28288-93

 [3] Kamberov ES., Atkinson MR., Ninfa AJ., 1995, The Escherichia coli PII signal transduction protein is activated upon binding 2-ketoglutarate and ATP., J Biol Chem 270(30):17797-807

 [4] Magasanik B., Bueno R., 1985, The role of uridylyltransferase and PII in the regulation of the synthesis of glutamine synthetase in Escherichia coli., Curr Top Cell Regul 27:215-20

 [5] Rhee SG., Park SC., Koo JH., 1985, The role of adenylyltransferase and uridylyltransferase in the regulation of glutamine synthetase in Escherichia coli., Curr Top Cell Regul 27:221-32

 [6] Tondervik A., Torgersen HR., Botnmark HK., Strom AR., 2006, Transposon mutations in the 5' end of glnD, the gene for a nitrogen regulatory sensor, that suppress the osmosensitive phenotype caused by otsBA lesions in Escherichia coli., J Bacteriol 188(12):4218-26

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB