RegulonDB RegulonDB 10.8: Gene Form
   

dcd gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

asmA udk dcd TSS_2402 TSS_2402 TSS_2401 TSS_2401 TSS_2400 TSS_2400 TSS_2399 TSS_2399

Gene      
Name: dcd    Texpresso search in the literature
Synonym(s): ECK2059, EG11418, b2065, dus, paxA
Genome position(nucleotides): 2141634 <-- 2142215 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
60.31
External database links:  
ASAP:
ABE-0006835
CGSC:
875
ECHOBASE:
EB1389
OU-MICROARRAY:
b2065
PortEco:
dcd
STRING:
511145.b2065
COLOMBOS: dcd


Product      
Name: dCTP deaminase
Synonym(s): Dcd, Dus, PaxA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.249
Isoelectric point: 5.69
Motif(s):
 
Type Positions Sequence
122 -> 122 V
78 -> 185 GEAFYLHPGELALAVTLESVTLPADLVGWLDGRSSLARLGLMVHVTAHRIDPGWSGCIVLEFYNSGKLPLALRPGMLIGALSFEPLSGPAVRPYNRREDAKYRNQQGA
171 -> 174 YNRR
110 -> 115 RSSLAR
111 -> 111 S

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0008829 - dCTP deaminase activity
GO:0042802 - identical protein binding
biological_process GO:0009117 - nucleotide metabolic process
GO:0015949 - nucleobase-containing small molecule interconversion
GO:0006226 - dUMP biosynthetic process
GO:0009314 - response to radiation
GO:0006229 - dUTP biosynthetic process
GO:0006235 - dTTP biosynthetic process
GO:0070207 - protein homotrimerization
Note(s): Note(s): ...[more].
Reference(s): [1] Estevenon AM., et al., 1995
[2] Estevenon AM., et al., 1985
[3] Koonin EV. 1996
[4] Lee HC., et al., 2009
[5] Sargentini NJ., et al., 2016
[6] Weiss B. 2007
External database links:  
ECOCYC:
DCTP-DEAM-MONOMER
ECOLIWIKI:
b2065
INTERPRO:
IPR011962
INTERPRO:
IPR029054
INTERPRO:
IPR033704
INTERPRO:
IPR036157
MODBASE:
P28248
PDB:
2V9X
PDB:
2J4H
PDB:
1XS6
PDB:
1XS4
PDB:
1XS1
PDB:
2J4Q
PFAM:
PF00692
PRIDE:
P28248
PRODB:
PRO_000022406
REFSEQ:
NP_416569
SMR:
P28248
UNIPROT:
P28248


Operon      
Name: udk-dcd         
Operon arrangement:
Transcription unit        Promoter
dcd
udk-dcd


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2399 2140025 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_2400 2140792 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_2401 2140838 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_2402 2142279 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Estevenon AM., Kooistra J., Sicard N., 1995, An Escherichia coli strain deficient for both exonuclease V and deoxycytidine triphosphate deaminase shows enhanced sensitivity to ionizing radiation., Mol Gen Genet 246(4):514-8

 [2] Estevenon AM., Martin B., Sicard N., 1985, Characterization of a mutation conferring radiation sensitivity, ior, located close to the gene coding for deoxycytidine deaminase in Escherichia coli., Mol Gen Genet 200(1):132-7

 [3] Koonin EV., 1996, Pseudouridine synthases: four families of enzymes containing a putative uridine-binding motif also conserved in dUTPases and dCTP deaminases., Nucleic Acids Res 24(12):2411-5

 [4] Lee HC., Kim JH., Kim JS., Jang W., Kim SY., 2009, Fermentative production of thymidine by a metabolically engineered Escherichia coli strain., Appl Environ Microbiol 75(8):2423-32

 [5] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [6] Weiss B., 2007, The deoxycytidine pathway for thymidylate synthesis in Escherichia coli., J Bacteriol 189(21):7922-6

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB