RegulonDB RegulonDB 10.9: Gene Form
   

waaU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

waaU waaZ waaL yibY waaUp8 waaUp8 waaUp6 waaUp6 waaUp5 waaUp5 waaUp9 waaUp9

Gene      
Name: waaU    Texpresso search in the literature
Synonym(s): ECK3613, EG11423, b3623, rfaK
Genome position(nucleotides): 3798239 <-- 3799312 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
31.01
External database links:  
ASAP:
ABE-0011851
CGSC:
33791
ECHOBASE:
EB1393
ECOLIHUB:
waaU
NCBI-GENE:
948147
OU-MICROARRAY:
b3623
STRING:
511145.b3623
COLOMBOS: waaU


Product      
Name: putative ADP-heptose:LPS heptosyltransferase 4
Synonym(s): ADP-L-glycero-beta;-D-manno-heptose:LPS heptosyltransferase IV, RfaK, WaaU, heptosyl transferase IV, putative UDP-N-acetyl-D-glucosaminyl transferase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 41.729
Isoelectric point: 8.843
Motif(s):
 
Type Positions Sequence
227 -> 235 EQIKVIYQE
274 -> 331 VALTKYSDFVISVDTALVHIAAAYHKPTLAFYPNSRTPEYPSHLIWSPNHHKSIQIVS
261 -> 269 EIETLPFDE
293 -> 293 I

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.2 - core region
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0008917 - lipopolysaccharide N-acetylglucosaminyltransferase activity
GO:0008713 - ADP-heptose-lipopolysaccharide heptosyltransferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009244 - lipopolysaccharide core region biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT9
DIP:
DIP-10672N
ECOCYC:
EG11423-MONOMER
ECOLIWIKI:
b3623
INTERPRO:
IPR002201
MODBASE:
P27242
PFAM:
PF01075
PRIDE:
P27242
PRODB:
PRO_000024215
REFSEQ:
NP_418080
SMR:
P27242
UNIPROT:
P27242


Operon      
Name: rirA-waaQGPSBOJYZU         
Operon arrangement:
Transcription unit        Promoter
rfaYZ
rfaQGPSBIJYZ-waaU
rirA-rfaQGPSBIJYZ-waaU
rfaZ-waaU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter waaUp9 3799398 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter waaUp5 3799424 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter waaUp6 3799496 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter waaUp8 3799498 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB