RegulonDB RegulonDB 10.9: Gene Form
   

wecC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wecC wecB rffG wzzE rffH rffC TSS_4444 TSS_4444 TSS_4443 TSS_4443 TSS_4442 TSS_4442 TSS_4441 (cluster) TSS_4441 (cluster) TSS_4440 TSS_4440 TSS_4439 TSS_4439

Gene      
Name: wecC    Texpresso search in the literature
Synonym(s): ECK3779, EG11452, b3787, mnaB, rff, rffD
Genome position(nucleotides): 3971260 --> 3972522 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.76
External database links:  
ASAP:
ABE-0012374
CGSC:
293
ECHOBASE:
EB1421
ECOLIHUB:
rffD
OU-MICROARRAY:
b3787
STRING:
511145.b3787
COLOMBOS: wecC


Product      
Name: UDP-N-acetyl-D-mannosamine dehydrogenase
Synonym(s): MnaB, Rff, RffD, WecC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.839
Isoelectric point: 5.054
Motif(s):
 
Type Positions Sequence
5 -> 189 TISVIGLGYIGLPTAAAFASRQKQVIGVDINQHAVDTINRGEIHIVEPDLASVVKTAVEGGFLRASTTPVEADAWLIAVPTPFKGDHEPDMTYVESAARSIAPVLKKGALVILESTSPVGSTEKMAEWLAEMRPDLTFPQQVGEQADVNIAYCPERVLPGQVMVELIKNDRVIGGMTPVCSARAS
160 -> 161 RV
324 -> 419 ACFGLAFKPNIDDLRESPAMEIAELIAQWHSGETLVVEPNIHQLPKKLTGLCTLAQLDEALATADVLVMLVDHSQFKVINGDNVHQQYVVDAKGVW
330 -> 331 FK
78 -> 78 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.4 - enterobacterial common antigen (surface glycolipid)
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0016628 - oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0051287 - NAD binding
GO:0089714 - UDP-N-acetyl-D-mannosamine dehydrogenase activity
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0009246 - enterobacterial common antigen biosynthetic process
GO:0055114 - oxidation-reduction process
External database links:  
ECOCYC:
UDPMANNACADEHYDROG-MONOMER
ECOLIWIKI:
b3787
INTERPRO:
IPR028359
INTERPRO:
IPR036291
INTERPRO:
IPR036220
INTERPRO:
IPR032891
INTERPRO:
IPR017476
INTERPRO:
IPR014027
INTERPRO:
IPR014026
INTERPRO:
IPR008927
INTERPRO:
IPR001732
MODBASE:
P27829
PFAM:
PF03720
PFAM:
PF00984
PFAM:
PF03721
PRIDE:
P27829
REFSEQ:
YP_026254
SMART:
SM00984
SMR:
P27829
UNIPROT:
P27829


Operon      
Name: rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM         
Operon arrangement:
Transcription unit        Promoter
rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4439 3969127 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4440 3969130 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4441 (cluster) 3969176 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4442 3969944 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4443 3969950 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4444 3971398 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB