RegulonDB RegulonDB 10.9: Gene Form
   

wecE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wzxE wecE rffC rffH wecF TSS_4445 (cluster) TSS_4445 (cluster)

Gene      
Name: wecE    Texpresso search in the literature
Synonym(s): ECK3783, EG11456, b3791, fcnA, rff, rffA, yifI
Genome position(nucleotides): 3975146 --> 3976276 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.38
External database links:  
ASAP:
ABE-0012384
ECHOBASE:
EB1425
ECOLIHUB:
rffA
OU-MICROARRAY:
b3791
STRING:
511145.b3791
COLOMBOS: wecE


Product      
Name: dTDP-4-dehydro-6-deoxy-D-glucose transaminase
Synonym(s): FcnA, Rff, RffA, WecE, YifI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.901
Isoelectric point: 6.046
Motif(s):
 
Type Positions Sequence
13 -> 371 ELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKGRALGTIGHIGCFSFHETKNYTAGGEGGATLINDKALIERAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPSIPDGCVQNAHMFYIKLRDIDDRSALINFLKEAEIMAVFHYIPLHGCPAGEHFGEFHGEDRYTTKESERLLRLPLFYNLSPVNQRTVIATL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.4 - enterobacterial common antigen (surface glycolipid)
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0008483 - transaminase activity
GO:0030170 - pyridoxal phosphate binding
GO:0042802 - identical protein binding
GO:0019180 - dTDP-4-amino-4,6-dideoxygalactose transaminase activity
biological_process GO:0000271 - polysaccharide biosynthetic process
GO:0009246 - enterobacterial common antigen biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Yoon JA., et al., 2012
External database links:  
ECOCYC:
RFFTRANS-MONOMER
ECOLIWIKI:
b3791
INTERPRO:
IPR032894
INTERPRO:
IPR015424
INTERPRO:
IPR000653
INTERPRO:
IPR012749
INTERPRO:
IPR015421
INTERPRO:
IPR015422
MODBASE:
P27833
PANTHER:
PTHR30244
PDB:
4ZAH
PDB:
4PIW
PFAM:
PF01041
PRIDE:
P27833
PRODB:
PRO_000023732
REFSEQ:
NP_418238
SMR:
P27833
UNIPROT:
P27833


Operon      
Name: rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM         
Operon arrangement:
Transcription unit        Promoter
rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4445 (cluster) 3977392 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Yoon JA., Kim BG., Lee WJ., Lim Y., Chong Y., Ahn JH., 2012, Production of a novel quercetin glycoside through metabolic engineering of Escherichia coli., Appl Environ Microbiol 78(12):4256-62

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB