RegulonDB RegulonDB 10.9: Gene Form
   

rffM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yifK wzyE rffM wecF TSS_4449 TSS_4449 TSS_4448 TSS_4448 TSS_4447 (cluster) TSS_4447 (cluster) TSS_4446 TSS_4446

Gene      
Name: rffM    Texpresso search in the literature
Synonym(s): ECK3787, EG11458, b3794, rff, wecG
Genome position(nucleotides): 3979956 --> 3980696 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.17
External database links:  
ASAP:
ABE-0012394
CGSC:
33948
ECHOBASE:
EB1427
ECOLIHUB:
rffM
OU-MICROARRAY:
b3794
STRING:
511145.b3794
COLOMBOS: rffM


Product      
Name: UDP-N-acetyl-D-mannosaminuronic acid transferase
Synonym(s): Rff, RffM, WecG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.928
Isoelectric point: 9.984
Motif(s):
 
Type Positions Sequence
120 -> 121 VL
66 -> 231 EFKYADGISVVRSVRKKYPQAQVSRVAGADLWEELMARAGKEGTPVFLVGGKPEVLAQTEAKLRNQWNVNIVGSQDGYFKPEQRQALFERIHASGAQIVTVAMGSPKQEIIMRDCRLVHPDALYMGVGGTYDVFTGHVKRAPKIWQTLGLEWLYRLLSQPSRIKRQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.4 - enterobacterial common antigen (surface glycolipid)
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016758 - transferase activity, transferring hexosyl groups
GO:0016740 - transferase activity
GO:0047241 - lipopolysaccharide N-acetylmannosaminouronosyltransferase activity
biological_process GO:0009058 - biosynthetic process
GO:0009246 - enterobacterial common antigen biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Erbel PJ., et al., 2003
External database links:  
CAZY:
GT26
DIP:
DIP-11132N
ECOCYC:
UDPMANACATRANS-MONOMER
ECOLIWIKI:
b3794
INTERPRO:
IPR004629
INTERPRO:
IPR023085
PANTHER:
PTHR34136
PFAM:
PF03808
PRIDE:
P27836
REFSEQ:
NP_418242
SMR:
P27836
UNIPROT:
P27836


Operon      
Name: rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM         
Operon arrangement:
Transcription unit        Promoter
rfe-wzzE-wecBC-rffGHC-wecE-wzxE-wecF-wzyE-rffM


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4446 3979755 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4447 (cluster) 3979832 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_4448 3979835 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4449 3982165 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Erbel PJ., Barr K., Gao N., Gerwig GJ., Rick PD., Gardner KH., 2003, Identification and biosynthesis of cyclic enterobacterial common antigen in Escherichia coli., J Bacteriol 185(6):1995-2004

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB