RegulonDB RegulonDB 10.9: Gene Form
   

corA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

corA yigF unknown ysgD TSS_4478 TSS_4478

Gene      
Name: corA    Texpresso search in the literature
Synonym(s): ECK3810, EG11463, b3816
Genome position(nucleotides): 4001426 --> 4002376 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.68
External database links:  
ASAP:
ABE-0012464
CGSC:
911
ECHOBASE:
EB1431
ECOLIHUB:
corA
OU-MICROARRAY:
b3816
STRING:
511145.b3816
COLOMBOS: corA


Shine dalgarno      
Sequence: ttaagcattgGGAGTCccggtcATG


Product      
Name: Ni2+/Co2+/Mg2+ transporter
Synonym(s): CorA, CorA magnesium ion MIT transporter, nickel/cobalt/magnesium transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 36.59
Isoelectric point: 4.355
Motif(s):
 
Type Positions Sequence
277 -> 279 GMN
288 -> 310 WSFGYPGAIIFMILAGLAPYLYF
49 -> 50 SL
26 -> 312 AVWIDLVEPDDDERLRVQSELGQSLATRPELEDIEASARFFEDDDGLHIHSFFFFEDAEDHAGNSTVAFTIRDGRLFTLRERELPAFRLYRMRARSQSMVDGNAYELLLDLFETKIEQLADEIENIYSDLEQLSRVIMEGHQGDEYDEALSTLAELEDIGWKVRLCLMDTQRALNFLVRKARLPGGQLEQAREILRDIESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFEFMPELKWSFGYPGAIIFMILAGLAPYLYFKR
255 -> 273 IIKIFSVVSVVFLPPTLVA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015087 - cobalt ion transmembrane transporter activity
GO:0046873 - metal ion transmembrane transporter activity
GO:0015095 - magnesium ion transmembrane transporter activity
GO:0015099 - nickel cation transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0030001 - metal ion transport
GO:0006824 - cobalt ion transport
GO:0015693 - magnesium ion transport
GO:0055085 - transmembrane transport
GO:0035444 - nickel cation transmembrane transport
GO:1903830 - magnesium ion transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CORA-MONOMER
ECOLIWIKI:
b3816
INTERPRO:
IPR004488
PDB:
5N77
PDB:
5N78
PFAM:
PF01544
PRIDE:
P0ABI4
PRODB:
PRO_000022320
REFSEQ:
NP_418260
SMR:
P0ABI4
UNIPROT:
P0ABI4


Operon      
Name: corA         
Operon arrangement:
Transcription unit        Promoter
corA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4478 4001273 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB