RegulonDB RegulonDB 10.9: Gene Form
   

yigI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rarD pldA yigI terminator pldAp pldAp TSS_4479 TSS_4479 yigIp yigIp rarDp5 rarDp5 rarDp3 rarDp3 rarDp4 rarDp4 rarDp2 rarDp2 rarDp1 rarDp1

Gene      
Name: yigI    Texpresso search in the literature
Synonym(s): ECK3814, EG11467, b3820
Genome position(nucleotides): 4004230 <-- 4004697 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.21
External database links:  
ASAP:
ABE-0012474
ECHOBASE:
EB1435
ECOLIHUB:
yigI
OU-MICROARRAY:
b3820
STRING:
511145.b3820
COLOMBOS: yigI


Product      
Name: putative thioesterase YigI
Synonym(s): YigI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.163
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
57 -> 145 SILHGGVIASALDVAAGLVCVGSTLTRHETISEDELRQRLSRMGTIDLRVDYLRPGRGERFTATSSLLRAGNKVAVARVELHNEEQLYI
96 -> 96 L

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016289 - CoA hydrolase activity
GO:0061522 - 1,4-dihydroxy-2-naphthoyl-CoA thioesterase activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11467-MONOMER
ECOLIWIKI:
b3820
INTERPRO:
IPR006683
INTERPRO:
IPR029069
INTERPRO:
IPR003736
MODBASE:
P0ADP2
PFAM:
PF03061
PRIDE:
P0ADP2
REFSEQ:
NP_418264
SMR:
P0ADP2
UNIPROT:
P0ADP2


Operon      
Name: yigI         
Operon arrangement:
Transcription unit        Promoter
yigI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rarDp1 4004227 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rarDp2 4004231 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rarDp4 4004241 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rarDp3 4004258 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rarDp5 4004297 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_4479 4004725 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB