RegulonDB RegulonDB 10.9: Gene Form
   

rhtC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recQ rhtC rhtB pldBp4 pldBp4 pldBp6 pldBp6 rhtCp2 rhtCp2 TSS_4480 TSS_4480

Gene      
Name: rhtC    Texpresso search in the literature
Synonym(s): ECK3817, EG11468, b3823, yigJ
Genome position(nucleotides): 4007757 --> 4008377 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.5
External database links:  
ASAP:
ABE-0012487
ECHOBASE:
EB1436
ECOLIHUB:
rhtC
OU-MICROARRAY:
b3823
STRING:
511145.b3823
COLOMBOS: rhtC


Product      
Name: L-threonine exporter
Synonym(s): RhtC, YigJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 22.474
Isoelectric point: 10.57
Motif(s):
 
Type Positions Sequence
1 -> 21 MLMLFLTVAMVHIVALMSPGP
150 -> 173 WGIFALIIVETLAWFTVVASLFAL
44 -> 64 GITCGVMVWAGIALLGLHLII
67 -> 87 MAWLHTLIMVGGGLYLCWMGY
14 -> 205 VALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGIALLGLHLIIEKMAWLHTLIMVGGGLYLCWMGYQMLRGALKKEAVSAPAPQVELAKSGRSFLKGLLTNLANPKAIIYFGSVFSLFVGDNVGTTARWGIFALIIVETLAWFTVVASLFALPQMRRGYQRLAKWIDGFAGALFAGFGIHLIIS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.8 - threonine
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015291 - secondary active transmembrane transporter activity
GO:0015171 - amino acid transmembrane transporter activity
GO:0015565 - threonine efflux transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0003333 - amino acid transmembrane transport
GO:0015826 - threonine transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jones CM., et al., 2015
[2] Kutukova EA., et al., 2005
[3] Xu Y., et al., 2017
[4] Zakataeva NP., et al., 2006
External database links:  
ECOCYC:
RHTC-MONOMER
ECOLIWIKI:
b3823
INTERPRO:
IPR004778
INTERPRO:
IPR001123
PANTHER:
PTHR30086
PFAM:
PF01810
PRIDE:
P0AG38
PRODB:
PRO_000023749
REFSEQ:
YP_026264
UNIPROT:
P0AG38


Operon      
Name: rhtC         
Operon arrangement:
Transcription unit        Promoter
rhtC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4480 4007726 forward nd [RS-EPT-CBR] [5]
  promoter rhtCp2 4007739 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter pldBp6 4009014 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter pldBp4 4009023 forward Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jones CM., Hernandez Lozada NJ., Pfleger BF., 2015, Efflux systems in bacteria and their metabolic engineering applications., Appl Microbiol Biotechnol 99(22):9381-93

 [2] Kutukova EA., Zakataeva NP., Livshits VA., 2005, [Expression of the genes encoding RhtB family proteins depends on global regulator Lrp], Mol Biol (Mosk) 39(3):374-8

 [3] Xu Y., Liu Y., Li F., Cao G., Zheng P., Sun J., Wen J., Zhang D., 2017, Identification of a new gene yecC involved in threonine export in Escherichia coli., FEMS Microbiol Lett 364(17)

 [4] Zakataeva NP., Kutukova EA., Gronskii SV., Troshin PV., Livshits VA., Aleshin VV., 2006, [Export of metabolites by the proteins of the DMT and RhtB families and its possible role in intercellular communication], Mikrobiologiia 75(4):509-20

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB