RegulonDB RegulonDB 10.9: Gene Form
   

yigL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pldB bioP yigL metR yigMp3 yigMp3 TSS_4482 (cluster) TSS_4482 (cluster)

Gene      
Name: yigL    Texpresso search in the literature
Synonym(s): ECK3820, EG11470, b3826
Genome position(nucleotides): 4010200 --> 4011000 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.56
Reference(s): [1] Talukder AA., et al., 2005
External database links:  
ASAP:
ABE-0012500
ECHOBASE:
EB1438
ECOLIHUB:
yigL
ECOO157CYC:
Z5347
OU-MICROARRAY:
b3826
STRING:
511145.b3826
COLOMBOS: yigL


Product      
Name: phosphosugar phosphatase YigL
Synonym(s): YigL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.708
Isoelectric point: 5.156
Motif(s):
 
Type Positions Sequence
5 -> 260 VASDLDGTLLSPDHTLSPYAKETLKLLTARGINFVFATGRHHVDVGQIRDNLEIKSYMITSNGARVHDLDGNLIFAHNLDRDIASDLFGVVNDNPDIITNVYRDDEWFMNRHRPEEMRFFKEAVFQYALYEPGLLEPEGVSKVFFTCDSHEQLLPLEQAINARWGDRVNVSFSTLTCLEVMAGGVSKGHALEAVAKKLGYSLKDCIAFGDGMNDAEMLSMAGKGCIMGSAHQRLKDLHPELEVIGTNADDAVPHYL
42 -> 43 TG

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016791 - phosphatase activity
GO:0050308 - sugar-phosphatase activity
GO:0000287 - magnesium ion binding
GO:0033883 - pyridoxal phosphatase activity
biological_process GO:0006950 - response to stress
GO:0016311 - dephosphorylation
Note(s): Note(s): ...[more].
Reference(s): [2] Bobrovskyy M., et al., 2016
External database links:  
ECOCYC:
EG11470-MONOMER
ECOLIWIKI:
b3826
ECOO157CYC:
Z5347-MONOMER
INTERPRO:
IPR036412
INTERPRO:
IPR023214
INTERPRO:
IPR000150
INTERPRO:
IPR006379
MODBASE:
P27848
PFAM:
PF08282
PRIDE:
P27848
PROSITE:
PS01229
PROSITE:
PS01228
REFSEQ:
YP_026267
SMR:
P27848
UNIPROT:
P27848


Operon      
Name: pldB-yigL         
Operon arrangement:
Transcription unit        Promoter
pldB-yigL


Regulation by small RNA    
  Display Regulation
small RNA sgrS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4482 (cluster) 4010009 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter yigMp3 4011050 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Talukder AA., Yanai S., Yamada M., 2005, Analysis of reading frame and expressional regulation of randomly selected promoter-proximal genes in Escherichia coli., J Gen Appl Microbiol 51(2):93-103

 [2] Bobrovskyy M., Vanderpool CK., 2016, Diverse mechanisms of post-transcriptional repression by the small RNA regulator of glucose-phosphate stress., Mol Microbiol 99(2):254-73

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB