RegulonDB RegulonDB 10.9: Gene Form
   

bioP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metE metR bioP yigL MetJ MetJ OxyR MetR OxyR MetR TSS_4502 TSS_4502 TSS_4501 TSS_4501 TSS_4500 TSS_4500 TSS_4499 TSS_4499 TSS_4498 TSS_4498 TSS_4497 TSS_4497 TSS_4496 TSS_4496 TSS_4495 TSS_4495 TSS_4494 TSS_4494 TSS_4493 TSS_4493 TSS_4492 TSS_4492 TSS_4491 TSS_4491 TSS_4490 TSS_4490 TSS_4489 TSS_4489 TSS_4488 TSS_4488 TSS_4487 TSS_4487 TSS_4486 TSS_4486 TSS_4485 TSS_4485 TSS_4484 TSS_4484 metEp metEp metRp1 metRp1 metRp2 metRp2 yigMp3 yigMp3

Gene      
Name: bioP    Texpresso search in the literature
Synonym(s): ECK3821, EG11471, b3827, yigM
Genome position(nucleotides): 4011076 --> 4011975 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0012504
ECHOBASE:
EB1439
ECOLIHUB:
yigM
OU-MICROARRAY:
b3827
STRING:
511145.b3827
COLOMBOS: bioP


Product      
Name: biotin transporter
Synonym(s): BioP, BirB, YigM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.727
Isoelectric point: 9.867
Motif(s):
 
Type Positions Sequence
3 -> 128 LLIITTILWAFSFSFYGEYLAGHVDSYFAVLVRVGLAALVFLPFLRTRGNSLKTVGLYMLVGAMQLGVMYMLSFRAYLYLTVSELLLFTVLTPLYITLIYDIMSKRRLRWGYAFSALLAVIGAGII
28 -> 47 SYFAVLVRVGLAALVFLPFL
231 -> 253 AGTLGIMNNMHVPAGLLVNLAIW
56 -> 76 TVGLYMLVGAMQLGVMYMLSF
80 -> 102 LYLTVSELLLFTVLTPLYITLIY

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015225 - biotin transmembrane transporter activity
biological_process GO:0015878 - biotin transport
Note(s): Note(s): ...[more].
Reference(s): [1] Campbell A., et al., 1980
[2] Campbell A., et al., 1972
[3] Cicmanec JF., et al., 1978
[4] Eisenberg MA. 1973
[5] Eisenberg MA., et al., 1975
[6] Finkenwirth F., et al., 2013
[7] Hebbeln P., et al., 2007
[8] Pai CH. 1972
[9] Pai CH., et al., 1969
[10] Piffeteau A., et al., 1985
[11] Piffeteau A., et al., 1982
External database links:  
ECOCYC:
EG11471-MONOMER
ECOLIWIKI:
b3827
INTERPRO:
IPR000620
INTERPRO:
IPR004779
PFAM:
PF00892
PRIDE:
P0ADP5
REFSEQ:
NP_418271
UNIPROT:
P0ADP5


Operon      
Name: bioP         
Operon arrangement:
Transcription unit        Promoter
bioP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yigMp3 4011050 forward Similarity to the consensus
Read more >
[ICWHO] [12]
  promoter TSS_4484 4012886 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4485 4012922 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4486 4012947 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4487 4013010 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4488 4013017 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4489 4013034 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4490 4013061 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4491 4013079 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4492 4013127 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4493 4013584 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4494 4013877 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4495 4013894 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4496 4013905 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4497 4013974 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4498 4014376 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4499 4014407 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4500 4014445 forward nd [RS-EPT-CBR] [13]
  promoter TSS_4501 4014468 reverse nd [RS-EPT-CBR] [13]
  promoter TSS_4502 4015162 forward nd [RS-EPT-CBR] [13]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Campbell A., Chang R., Barker D., Ketner G., 1980, Biotin regulatory (bir) mutations of Escherichia coli., J Bacteriol 142(3):1025-8

 [2] Campbell A., Del Campillo-Campbell A., Chang R., 1972, A mutant of Escherichia coli that requires high concentrations of biotin., Proc Natl Acad Sci U S A 69(3):676-80

 [3] Cicmanec JF., Lichstein HC., 1978, Uptake of extracellular biotin by Escherichia coli biotin prototrophs., J Bacteriol 133(1):270-8

 [4] Eisenberg MA., 1973, Biotin: biogenesis, transport, and their regulation., Adv Enzymol Relat Areas Mol Biol 38:317-72

 [5] Eisenberg MA., Mee B., Prakash O., Eisenberg MR., 1975, Properties of alpha-dehydrobiotin-resistant mutants of Escherichia coli K-12., J Bacteriol 122(1):66-72

 [6] Finkenwirth F., Kirsch F., Eitinger T., 2013, Solitary BioY proteins mediate biotin transport into recombinant Escherichia coli., J Bacteriol 195(18):4105-11

 [7] Hebbeln P., Rodionov DA., Alfandega A., Eitinger T., 2007, Biotin uptake in prokaryotes by solute transporters with an optional ATP-binding cassette-containing module., Proc Natl Acad Sci U S A 104(8):2909-14

 [8] Pai CH., 1972, Mutant of Escherichia coli with derepressed levels of the biotin biosynthetic enzymes., J Bacteriol 112(3):1280-7

 [9] Pai CH., McLaughlin GE., 1969, Uptake of pimelic acid by Escherichia coli and Pseudomonas denitrificans., Can J Microbiol 15(7):809-10

 [10] Piffeteau A., Gaudry M., 1985, Biotin uptake: influx, efflux and countertransport in Escherichia coli K12., Biochim Biophys Acta 816(1):77-82

 [11] Piffeteau A., Zamboni M., Gaudry M., 1982, Biotin transport by a biotin-deficient strain of Escherichia coli., Biochim Biophys Acta 688(1):29-36

 [12] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [13] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB