RegulonDB RegulonDB 10.9: Gene Form
   

pabC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fabF mltG pabC tmk TSS_1418 TSS_1418 pabCp1 pabCp1 pabCp5 pabCp5 pabCp8 pabCp8 TSS_1417 TSS_1417 TSS_1416 (cluster) TSS_1416 (cluster)

Gene      
Name: pabC    Texpresso search in the literature
Synonym(s): ECK1082, EG11493, b1096
Genome position(nucleotides): 1153300 --> 1154109 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.62
External database links:  
ASAP:
ABE-0003709
CGSC:
31889
ECHOBASE:
EB1456
ECOLIHUB:
pabC
OU-MICROARRAY:
b1096
STRING:
511145.b1096
COLOMBOS: pabC


Product      
Name: aminodeoxychorismate lyase
Synonym(s): PabC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.715
Isoelectric point: 6.491
Motif(s):
 
Type Positions Sequence
24 -> 246 GCFTTARVIDGKVSLLSAHIQRLQDACQRLMISCDFWPQLEQEMKTLAAEQQNGVLKVVISRGSGGRGYSTLNSGPATRILSVTAYPAHYDRLRNEGITLALSPVRLGRNPHLAGIKHLNRLEQVLIRSHLEQTNADEALVLDSEGWVTECCAANLFWRKGNVVYTPRLDQAGVNGIMRQFCIRLLAQSSYQLVEVQASLEESLQADEMVICNALMPVMPVCA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0030170 - pyridoxal phosphate binding
GO:0008696 - 4-amino-4-deoxychorismate lyase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0008153 - para-aminobenzoic acid biosynthetic process
GO:0046656 - folic acid biosynthetic process
GO:0046654 - tetrahydrofolate biosynthetic process
External database links:  
DIP:
DIP-10435N
ECOCYC:
ADCLY-MONOMER
ECOLIWIKI:
b1096
INTERPRO:
IPR036038
INTERPRO:
IPR043132
INTERPRO:
IPR043131
INTERPRO:
IPR018300
INTERPRO:
IPR017824
INTERPRO:
IPR001544
MODBASE:
P28305
PDB:
1ET0
PDB:
1I2K
PDB:
1I2L
PFAM:
PF01063
PRIDE:
P28305
PRODB:
PRO_000023486
PROSITE:
PS00770
REFSEQ:
NP_415614
SMR:
P28305
UNIPROT:
P28305


Operon      
Name: pabC-mltG-tmk-holB-ycfH         
Operon arrangement:
Transcription unit        Promoter
pabC-mltG-tmk-holB-ycfH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1416 (cluster) 1152105 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1417 1152173 forward nd [RS-EPT-CBR] [1]
  promoter pabCp8 1153093 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter pabCp5 1153194 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter pabCp1 1153293 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1418 1155058 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB