RegulonDB RegulonDB 10.9: Gene Form
   

narP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ccmH insH8 narP ccmG narPp narPp TSS_2483 TSS_2483 yejOp yejOp

Gene      
Name: narP    Texpresso search in the literature
Synonym(s): ECK2185, EG11527, b2193
Genome position(nucleotides): 2290500 --> 2291147 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.47
External database links:  
ASAP:
ABE-0007259
CGSC:
32598
ECHOBASE:
EB1489
ECOLIHUB:
narP
OU-MICROARRAY:
b2193
STRING:
511145.b2193
COLOMBOS: narP


Product      
Name: DNA-binding transcriptional dual regulator NarP
Synonym(s): NarP, nitrate/nitrite response regulator NarP
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 23.575
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
153 -> 207 VLTERELDVLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATIL
147 -> 212 EEDPFSVLTERELDVLHELAQGLSNKQIASVLNISEQTVKVHIRNLLRKLNVRSRVAATILFLQQR
9 -> 121 VMIVDDHPLMRRGVRQLLELDPGSEVVAEAGDGASAIDLANRLDIDVILLDLNMKGMSGLDTLNALRRDGVTAQIIILTVSDASSDVFALIDAGADGYLLKDSDPEVLLEAIR
171 -> 190 NKQIASVLNISEQTVKVHIR
8 -> 124 QVMIVDDHPLMRRGVRQLLELDPGSEVVAEAGDGASAIDLANRLDIDVILLDLNMKGMSGLDTLNALRRDGVTAQIIILTVSDASSDVFALIDAGADGYLLKDSDPEVLLEAIRAGA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:0042128 - nitrate assimilation
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Browning DF., et al., 2005
[2] Darwin AJ., et al., 1997
[3] Pao GM., et al., 1995
[4] Parkinson JS. 1993
[5] Parkinson JS., et al., 1992
[6] Rabin RS., et al., 1993
[7] Stock JB., et al., 1990
External database links:  
DIP:
DIP-10317N
ECOCYC:
NARP-MONOMER
ECOLIWIKI:
b2193
INTERPRO:
IPR016032
INTERPRO:
IPR001789
INTERPRO:
IPR000792
INTERPRO:
IPR011006
MODBASE:
P31802
PFAM:
PF00072
PFAM:
PF00196
PRIDE:
P31802
PRINTS:
PR00038
PRODB:
PRO_000023357
PROSITE:
PS50110
PROSITE:
PS00622
PROSITE:
PS50043
REFSEQ:
NP_416697
SMART:
SM00448
SMART:
SM00421
SMR:
P31802
SWISSMODEL:
P31802
UNIPROT:
P31802


Operon      
Name: narP         
Operon arrangement:
Transcription unit        Promoter
narP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2483 2290072 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Browning DF., Grainger DC., Beatty CM., Wolfe AJ., Cole JA., Busby SJ., 2005, Integration of three signals at the Escherichia coli nrf promoter: a role for Fis protein in catabolite repression., Mol Microbiol 57(2):496-510

 [2] Darwin AJ., Tyson KL., Busby SJ., Stewart V., 1997, Differential regulation by the homologous response regulators NarL and NarP of Escherichia coli K-12 depends on DNA binding site arrangement., Mol Microbiol 25(3):583-95

 [3] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [4] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [5] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [6] Rabin RS., Stewart V., 1993, Dual response regulators (NarL and NarP) interact with dual sensors (NarX and NarQ) to control nitrate- and nitrite-regulated gene expression in Escherichia coli K-12., J Bacteriol 175(11):3259-68

 [7] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB